BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0615 (776 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302658-1|CAC35523.1| 145|Anopheles gambiae gSG7 protein protein. 25 2.6 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 24 4.6 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 24 4.6 >AJ302658-1|CAC35523.1| 145|Anopheles gambiae gSG7 protein protein. Length = 145 Score = 25.0 bits (52), Expect = 2.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 134 EAGNIPDSAGRSHPCLEQVNVKPT 205 +AGN+P SA S CL+Q+ + T Sbjct: 71 KAGNLPKSAKLSDGCLKQMVARVT 94 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 24.2 bits (50), Expect = 4.6 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 Query: 508 FTHQTNTYIHFLGARSKTCTFNKINILIDH*IC 410 + H T Y LGA + CT N N + H C Sbjct: 165 YYHFTVEYYTVLGAACQVCTPNATNTVWSHCQC 197 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 24.2 bits (50), Expect = 4.6 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 Query: 508 FTHQTNTYIHFLGARSKTCTFNKINILIDH*IC 410 + H T Y LGA + CT N N + H C Sbjct: 165 YYHFTVEYYTVLGAACQVCTPNATNTVWSHCQC 197 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 549,826 Number of Sequences: 2352 Number of extensions: 7649 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -