BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0615 (776 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ062768-1|AAY56641.1| 332|Drosophila melanogaster unknown prot... 57 3e-08 AY058282-1|AAL13511.1| 332|Drosophila melanogaster GH03305p pro... 57 3e-08 AE014134-2042|AAF53080.1| 332|Drosophila melanogaster CG6287-PA... 57 3e-08 >DQ062768-1|AAY56641.1| 332|Drosophila melanogaster unknown protein. Length = 332 Score = 56.8 bits (131), Expect = 3e-08 Identities = 32/62 (51%), Positives = 37/62 (59%) Frame = +3 Query: 3 PTDPVTLEIIQQPAVIATPHLGASTKEAQVRVGQEIAEQLVNLVKPGTFPTLLAEVTRVL 182 P VT +I P V+ATPHLGAST EAQVRV E+AEQ + L GT P V+ Sbjct: 267 PKSAVTKALISHPKVVATPHLGASTSEAQVRVAVEVAEQFIAL--NGTSPK-YTSYAGVI 323 Query: 183 NK 188 NK Sbjct: 324 NK 325 >AY058282-1|AAL13511.1| 332|Drosophila melanogaster GH03305p protein. Length = 332 Score = 56.8 bits (131), Expect = 3e-08 Identities = 32/62 (51%), Positives = 37/62 (59%) Frame = +3 Query: 3 PTDPVTLEIIQQPAVIATPHLGASTKEAQVRVGQEIAEQLVNLVKPGTFPTLLAEVTRVL 182 P VT +I P V+ATPHLGAST EAQVRV E+AEQ + L GT P V+ Sbjct: 267 PKSAVTKALISHPKVVATPHLGASTSEAQVRVAVEVAEQFIAL--NGTSPK-YTSYAGVI 323 Query: 183 NK 188 NK Sbjct: 324 NK 325 >AE014134-2042|AAF53080.1| 332|Drosophila melanogaster CG6287-PA protein. Length = 332 Score = 56.8 bits (131), Expect = 3e-08 Identities = 32/62 (51%), Positives = 37/62 (59%) Frame = +3 Query: 3 PTDPVTLEIIQQPAVIATPHLGASTKEAQVRVGQEIAEQLVNLVKPGTFPTLLAEVTRVL 182 P VT +I P V+ATPHLGAST EAQVRV E+AEQ + L GT P V+ Sbjct: 267 PKSAVTKALISHPKVVATPHLGASTSEAQVRVAVEVAEQFIAL--NGTSPK-YTSYAGVI 323 Query: 183 NK 188 NK Sbjct: 324 NK 325 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,273,193 Number of Sequences: 53049 Number of extensions: 347296 Number of successful extensions: 807 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3602427675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -