BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0610 (802 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 26 0.30 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 26 0.30 EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport pe... 24 1.6 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 3.7 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 26.2 bits (55), Expect = 0.30 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = -1 Query: 226 LYHIIPFLRSLPSYTYRLSRNPSISS*VYLFLYILPHS*LALSYQPHFHFVSSHVHTI 53 L +I L++ S+ L RN S+ VY+ LYIL LA + V+ +T+ Sbjct: 114 LQYIDEVLKNRDSHETNLLRNVSVQFFVYVILYILATVFLAYVWICEMGVVTLQAYTL 171 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 26.2 bits (55), Expect = 0.30 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = -1 Query: 226 LYHIIPFLRSLPSYTYRLSRNPSISS*VYLFLYILPHS*LALSYQPHFHFVSSHVHTI 53 L +I L++ S+ L RN S+ VY+ LYIL LA + V+ +T+ Sbjct: 114 LQYIDEVLKNRDSHETNLLRNVSVQFFVYVILYILATVFLAYVWICEMGVVTLQAYTL 171 >EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport peptide isoform B protein. Length = 120 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/26 (30%), Positives = 18/26 (69%) Frame = -1 Query: 451 ICKDRTTLFQNSKIIHVCASKLYATR 374 IC+D LF+ ++ ++C S+ ++T+ Sbjct: 68 ICEDCYMLFREPQLHNLCRSECFSTK 93 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -1 Query: 109 LALSYQPHFHFVSSHVHTIPNAHFSA 32 L SYQ HF+ + + HT P A Sbjct: 37 LRTSYQHHFNSPAGNAHTGPTGTHDA 62 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,052 Number of Sequences: 336 Number of extensions: 4785 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -