BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0608 (779 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F12.17 |rna14||mRNA cleavage and polyadenylation specificit... 26 5.3 SPAC1687.20c |mis6||inner centromere protein Mis6|Schizosaccharo... 26 5.3 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 26 7.0 SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 25 9.2 SPAC13C5.02 |dre4||DNA replication protein Dre4|Schizosaccharomy... 25 9.2 SPAC24C9.11 |||MIF4G/MA4 domain protein|Schizosaccharomyces pomb... 25 9.2 >SPAC6F12.17 |rna14||mRNA cleavage and polyadenylation specificity factor complex subunit Rna14|Schizosaccharomyces pombe|chr 1|||Manual Length = 733 Score = 26.2 bits (55), Expect = 5.3 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 240 SQFS*RTLD*QPHRKQLPVHLIYHVQSDLPQYSWALC 130 S S + D P K+LP HL+ + QYS A C Sbjct: 408 SSSSESSTDGNPQEKKLPEHLVKRKSRLVRQYSLAWC 444 >SPAC1687.20c |mis6||inner centromere protein Mis6|Schizosaccharomyces pombe|chr 1|||Manual Length = 672 Score = 26.2 bits (55), Expect = 5.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 409 TFCLLYISNLNPM*LQCSYGFPILQYCELLHIY 311 T + IS+L+P L+CSY L+H+Y Sbjct: 89 TIAIRIISSLDPHGLRCSYAIQAKLLNWLIHVY 121 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 25.8 bits (54), Expect = 7.0 Identities = 12/55 (21%), Positives = 27/55 (49%) Frame = +2 Query: 329 TILKNRKSIGTLQSHRIQIRDIQQTESKIKPPLIEEIKGKALSRSEAAHRKNEIV 493 T+ ++ S + + RD ++ + + PP+I +I + S + H K+ +V Sbjct: 958 TLYRHNDSDASAYVSSARRRDFKEEKIESAPPIINDIDSEIASLKKRIHEKSLVV 1012 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 25.4 bits (53), Expect = 9.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 302 QFEIDMQKFTILKNRKSIGTLQSHRIQIRDIQ 397 + ++ Q+FT LKN K+I +L+S + D Q Sbjct: 640 KLKLKYQQFTTLKNLKNIDSLESLELGHEDEQ 671 >SPAC13C5.02 |dre4||DNA replication protein Dre4|Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 25.4 bits (53), Expect = 9.2 Identities = 15/74 (20%), Positives = 41/74 (55%), Gaps = 1/74 (1%) Frame = +2 Query: 347 KSIGTLQSHRIQIRDIQQTESKIKPPL-IEEIKGKALSRSEAAHRKNEIVFRLRRSHQQG 523 +++ + +++ +I + + +++I+ P +EE +++ SE + K++ +SH Sbjct: 146 QNVDSGKTNHEEIHESRHLQTEIEEPSGLEESSEESVLYSEEFYEKSDEEEDEEKSHSAE 205 Query: 524 KLSIC*QNLKYQLQ 565 +L +++ YQLQ Sbjct: 206 ELEFGEEDIMYQLQ 219 >SPAC24C9.11 |||MIF4G/MA4 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 25.4 bits (53), Expect = 9.2 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 290 QDKYQFEIDMQKFTILKNRKSIGTLQSHRIQIRDIQQTESK 412 Q K++ ++KF +S+ + R+ + DI+Q E+K Sbjct: 473 QSKFEAVNQLKKFLGSLGNRSLNAREPLRVTLEDIEQIETK 513 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,192,467 Number of Sequences: 5004 Number of extensions: 67831 Number of successful extensions: 185 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 185 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 377352472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -