BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0607 (729 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-13|CAD27764.1| 319|Anopheles gambiae putative transcri... 27 0.79 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 2.4 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 9.7 >AJ439060-13|CAD27764.1| 319|Anopheles gambiae putative transcription factor protein. Length = 319 Score = 26.6 bits (56), Expect = 0.79 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 515 TVVNVDGPAPIHSGPLTQSPKKLDGGDLY 601 ++ + G P+H L+ P++LDGG Y Sbjct: 69 SIAHKAGAGPLHDKLLSPVPQRLDGGAAY 97 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.0 bits (52), Expect = 2.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 361 IIKGTQCLLSPQDIWTIPLTTFLVPMFRSK 450 +++G + L P D W PLT+ L SK Sbjct: 237 LVRGLERLNEPVDKWDTPLTSLLFYKLDSK 266 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 9.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 481 DSDGDKFIWAALSGTWAPE 425 DS G F+W G W+ E Sbjct: 83 DSSGIIFVWIKYEGRWSVE 101 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 710,284 Number of Sequences: 2352 Number of extensions: 14417 Number of successful extensions: 31 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -