BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0607 (729 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 25 0.55 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.2 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 6.8 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 6.8 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 6.8 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 6.8 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 6.8 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 6.8 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 6.8 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 6.8 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 6.8 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 6.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 6.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 6.8 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 6.8 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 6.8 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 6.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 6.8 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 6.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 6.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 6.8 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 9.0 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 25.4 bits (53), Expect = 0.55 Identities = 27/99 (27%), Positives = 36/99 (36%) Frame = +3 Query: 84 LRSSTNRGTKRKMSTSPTTTMMRATGRKEKCMTPT*ITIESNVAVNMKSQENDARQLQST 263 L SS N GT + +TSP T + E ++ + AVN Q N S+ Sbjct: 18 LFSSANPGTIQACTTSPATASL------ESSLSAAAVAA---AAVNYAQQHNSPSPTGSS 68 Query: 264 KTGSSLRIHEFTDERLGPASPPYEEMLAASADHYQRYAV 380 S R + PY AA H Q+ AV Sbjct: 69 PQHSGSSASTSPAARTTSSMYPYVSAAAAHHHHQQQQAV 107 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 2.2 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 Query: 60 CCWWRSRW 83 CCWW+ W Sbjct: 488 CCWWKICW 495 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 2.2 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 Query: 60 CCWWRSRW 83 CCWW+ W Sbjct: 541 CCWWKICW 548 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 117 PGSRHIGPLTPFPPRFIPPDMY 138 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 117 PGSRHIGPLTPFPPRFIPPDMY 138 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 117 PGSRHIGPLTPFPPRFIPPDMY 138 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 117 PGSRHIGPLTPFPPRFIPPDMY 138 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 117 PGSRHIGPLTPFPPRFIPPDMY 138 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 117 PGSRHIGPLTPFPPRFIPPDMY 138 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 117 PGSRHIGPLTPFPPRFIPPDMY 138 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 366 PGSRHIGPLTPFPPRFIPPDMY 387 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 366 PGSRHIGPLTPFPPRFIPPDMY 387 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 366 PGSRHIGPLTPFPPRFIPPDMY 387 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 366 PGSRHIGPLTPFPPRFIPPDMY 387 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 366 PGSRHIGPLTPFPPRFIPPDMY 387 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 366 PGSRHIGPLTPFPPRFIPPDMY 387 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 365 PGSRHIGPLTPFPPRFIPPDMY 386 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 350 PGSRHIGPLTPFPPRFIPPDMY 371 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 536 PAPIHSGPLTQSPKKLDGGDLY 601 P H GPLT P + D+Y Sbjct: 366 PGSRHIGPLTPFPPRFIPPDMY 387 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/38 (28%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 63 CWWRSR-WLRSSTNRGTKRKMSTSPTTTMMRATGRKEK 173 C W +R W TN G + T + G +EK Sbjct: 301 CTWAARPWQGYMTNNGVNNVEAVQKELTDLGKLGEEEK 338 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/38 (28%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 63 CWWRSR-WLRSSTNRGTKRKMSTSPTTTMMRATGRKEK 173 C W +R W TN G + T + G +EK Sbjct: 301 CTWAARPWQGYMTNNGVNNVEAVQKELTDLGKLGEEEK 338 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/38 (28%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 63 CWWRSR-WLRSSTNRGTKRKMSTSPTTTMMRATGRKEK 173 C W +R W TN G + T + G +EK Sbjct: 301 CTWAARPWQGYMTNNGVNNVEAVQKELTDLGKLGEEEK 338 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 9.0 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = -3 Query: 328 GGDAGPNLSSVNSCIRSDEPVLVLCSWRASFS*LFIFTATFDSMVIYVGVIHFS 167 GG + P+ SS +S S P + S LF+ FD + Y+ +++S Sbjct: 86 GGSSSPSPSSPSSFFSSVSPTSLGSENYTGISDLFV----FDDLNDYINRLNYS 135 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,391 Number of Sequences: 438 Number of extensions: 4029 Number of successful extensions: 32 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -