BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0606 (729 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ176868-1|AAZ85145.1| 1208|Homo sapiens RecQ protein-like 4 pro... 31 3.2 BC013277-1|AAH13277.2| 652|Homo sapiens RECQL4 protein protein. 31 3.2 BC011602-1|AAH11602.2| 741|Homo sapiens RECQL4 protein protein. 31 3.2 AB026546-1|BAA86899.1| 1208|Homo sapiens RECQL4 helicase protein. 31 3.2 AB006532-1|BAA74453.1| 1208|Homo sapiens DNA helicase protein. 31 3.2 >DQ176868-1|AAZ85145.1| 1208|Homo sapiens RecQ protein-like 4 protein. Length = 1208 Score = 31.5 bits (68), Expect = 3.2 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 108 KTILCNFLGFTILKRERSLKTKLRREFYKFHFIEIP 215 K +C+FL + RER +LRR F FH + P Sbjct: 1048 KDQICDFLYGRVQARERQALARLRRTFQAFHSVAFP 1083 >BC013277-1|AAH13277.2| 652|Homo sapiens RECQL4 protein protein. Length = 652 Score = 31.5 bits (68), Expect = 3.2 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 108 KTILCNFLGFTILKRERSLKTKLRREFYKFHFIEIP 215 K +C+FL + RER +LRR F FH + P Sbjct: 492 KDQICDFLYGRVQARERQALARLRRTFQAFHSVAFP 527 >BC011602-1|AAH11602.2| 741|Homo sapiens RECQL4 protein protein. Length = 741 Score = 31.5 bits (68), Expect = 3.2 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 108 KTILCNFLGFTILKRERSLKTKLRREFYKFHFIEIP 215 K +C+FL + RER +LRR F FH + P Sbjct: 581 KDQICDFLYGRVQARERQALARLRRTFQAFHSVAFP 616 >AB026546-1|BAA86899.1| 1208|Homo sapiens RECQL4 helicase protein. Length = 1208 Score = 31.5 bits (68), Expect = 3.2 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 108 KTILCNFLGFTILKRERSLKTKLRREFYKFHFIEIP 215 K +C+FL + RER +LRR F FH + P Sbjct: 1048 KDQICDFLYGRVQARERQALARLRRTFQAFHSVAFP 1083 >AB006532-1|BAA74453.1| 1208|Homo sapiens DNA helicase protein. Length = 1208 Score = 31.5 bits (68), Expect = 3.2 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 108 KTILCNFLGFTILKRERSLKTKLRREFYKFHFIEIP 215 K +C+FL + RER +LRR F FH + P Sbjct: 1048 KDQICDFLYGRVQARERQALARLRRTFQAFHSVAFP 1083 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,478,623 Number of Sequences: 237096 Number of extensions: 1577364 Number of successful extensions: 3037 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3037 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8623170556 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -