BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0605 (713 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |S... 26 4.7 SPBC119.01 |rpn3|SPBPJ4664.07|19S proteasome regulatory subunit ... 25 8.1 >SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |Schizosaccharomyces pombe|chr 2|||Manual Length = 1944 Score = 26.2 bits (55), Expect = 4.7 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -1 Query: 146 GFLLALSMAISTFTVHYQVACKLSSTAIKTGIFIFIYIYTKICGVLAC 3 G LA+ +A S TV Y + KL+ +++ T + I KIC L C Sbjct: 753 GSALAMCIADSLVTVSYWL--KLTDSSLLTSVVKVICKMLKICKKLEC 798 >SPBC119.01 |rpn3|SPBPJ4664.07|19S proteasome regulatory subunit Rpn3|Schizosaccharomyces pombe|chr 2|||Manual Length = 497 Score = 25.4 bits (53), Expect = 8.1 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 98 YQVACKLSSTAIKTGIFIFIYIYTKI 21 Y + C+L T IKTG+ + Y++I Sbjct: 355 YTLICRLRHTVIKTGLRMISLSYSRI 380 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,667,156 Number of Sequences: 5004 Number of extensions: 49620 Number of successful extensions: 76 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -