BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0604 (711 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 25 3.1 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 7.2 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 502 IIFCLK*GNKKQINSKKNNWCK*SRNNHNC 413 I+ CL G + QIN ++C+ R N C Sbjct: 9 IVSCLVSGLQAQINYCTTSYCRNGRQNVGC 38 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 7.2 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 441 HQLFFFELICFLFPYFKQNIILFVSSKRLQEQFKK 545 H LFF +I FL ++ N+IL + + E KK Sbjct: 403 HMLFFI-VIIFLGSFYLVNLILAIVAMSYDELQKK 436 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 701,554 Number of Sequences: 2352 Number of extensions: 13651 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -