BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0603 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 24 5.3 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 24 5.3 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.8 bits (49), Expect = 5.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 258 QSTPNTFSVLFIFILYRFNSPI 193 QS P+T + + +F+ R N P+ Sbjct: 103 QSNPDTLTAMAVFVRDRVNGPL 124 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.8 bits (49), Expect = 5.3 Identities = 20/72 (27%), Positives = 33/72 (45%) Frame = +3 Query: 330 LEQLTASKSKKKSKRIGNSESYIPENNLEYLKLATQNKKAIIDEQLLETTSKTIPH*RNK 509 L++L + R+ ES+ NLE L L+ A + L TT+ + RN Sbjct: 179 LQRLRVLNLRGNILRMLQRESFANLTNLEQLDLSYNYISAWNQQILTTTTALQSVNLRNN 238 Query: 510 SDDIMSRAMLHN 545 S I++ ML++ Sbjct: 239 SIVILTTDMLYD 250 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 573,889 Number of Sequences: 2352 Number of extensions: 9034 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -