BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0596 (777 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006708-15|AAF60425.1| 504|Caenorhabditis elegans Hypothetical... 30 2.1 AL132902-4|CAC14420.1| 1913|Caenorhabditis elegans Hypothetical ... 28 8.6 AF348166-1|AAK37544.1| 1221|Caenorhabditis elegans Toll-like rec... 28 8.6 AC006604-2|AAF39752.2| 1221|Caenorhabditis elegans Toll (drosoph... 28 8.6 >AC006708-15|AAF60425.1| 504|Caenorhabditis elegans Hypothetical protein Y110A7A.8 protein. Length = 504 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 119 QYKWYIKLSSRKTLL*NTVNLIHLYVTDKCFKIF 18 QYK +KLS + N +N+IH +V DK K F Sbjct: 98 QYKLIVKLSHVAADIDNEINVIHKFVRDKYEKRF 131 >AL132902-4|CAC14420.1| 1913|Caenorhabditis elegans Hypothetical protein Y71A12B.4 protein. Length = 1913 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 631 NTTTSGPKRISITNSKRRG*PSTHYSTT 714 +T+ GP +SI N RG P++ STT Sbjct: 4 HTSQPGPSHVSIVNVPERGGPTSSTSTT 31 >AF348166-1|AAK37544.1| 1221|Caenorhabditis elegans Toll-like receptor TOL-1 protein. Length = 1221 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 175 CLLHRSGNIYLGRVYAIMNHSYSL*NSEQGLII 273 CLLHR G Y ++AI + + +S Q LI+ Sbjct: 1086 CLLHRDGPTYCSNLHAISDELIAQMDSSQCLIL 1118 >AC006604-2|AAF39752.2| 1221|Caenorhabditis elegans Toll (drosophila) family protein 1 protein. Length = 1221 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 175 CLLHRSGNIYLGRVYAIMNHSYSL*NSEQGLII 273 CLLHR G Y ++AI + + +S Q LI+ Sbjct: 1086 CLLHRDGPTYCSNLHAISDELIAQMDSSQCLIL 1118 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,348,190 Number of Sequences: 27780 Number of extensions: 315181 Number of successful extensions: 722 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1872168044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -