BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0595 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 25 2.3 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 7.0 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 9.2 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 9.2 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 9.2 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.0 bits (52), Expect = 2.3 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 442 EDDEMKSEGERHGADE 395 EDDE + G+RH AD+ Sbjct: 1170 EDDEEEGSGDRHRADD 1185 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -1 Query: 472 LEHGRKNLDVEDDEMKSEGERHGADEPQV*PGRHGDQ 362 ++H + NLD ++D M + G D P D+ Sbjct: 757 MDHDKDNLDSDNDPMNISDDYDGQDSDTKIPVAEDDE 793 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.0 bits (47), Expect = 9.2 Identities = 7/33 (21%), Positives = 19/33 (57%) Frame = +2 Query: 329 NAMNSLSENQSLVTMPPWSNLWLVGSMALSFTL 427 + ++ EN+S+ P++++W ++ + F L Sbjct: 165 DGLSMRDENESITPFAPYTSIWSSPTVYICFAL 197 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 9.2 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -1 Query: 628 AQSIACRGASLGQCASHHRRSCARRI*ALHPAVPRVLRTSYGYP 497 A ++ C A+ QC+ HRR L VP L + +P Sbjct: 100 ASTVRCSFATSEQCSEWHRRI------TLSIGVPETLEALFAFP 137 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.0 bits (47), Expect = 9.2 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -1 Query: 628 AQSIACRGASLGQCASHHRRSCARRI*ALHPAVPRVLRTSYGYP 497 A ++ C A+ QC+ HRR L VP L + +P Sbjct: 100 ASTVRCSFATSEQCSEWHRRI------TLSIGVPETLEALFAFP 137 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,144 Number of Sequences: 2352 Number of extensions: 14690 Number of successful extensions: 32 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -