BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0590 (679 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0576 + 4280671-4280730,4280812-4280865,4280955-4281017,428... 29 4.5 >07_01_0576 + 4280671-4280730,4280812-4280865,4280955-4281017, 4281100-4281149,4281255-4281330,4281663-4281863, 4282414-4282501,4282606-4282691,4282773-4282859, 4283289-4283333,4283547-4283567 Length = 276 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 368 PLAGFEPTTPLYSDHVTYHYTRRPFVKWPLKF*NGIVVVCVI 493 P+A F + L H+T + F WPL + I++ C+I Sbjct: 120 PVAHFAKSEELLEQHITPTINKNLFKNWPLM--SSIILYCII 159 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,988,466 Number of Sequences: 37544 Number of extensions: 302673 Number of successful extensions: 547 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -