BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0590 (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11852| Best HMM Match : fn3 (HMM E-Value=1.2e-24) 28 8.0 SB_43085| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-08) 28 8.0 SB_11434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_11852| Best HMM Match : fn3 (HMM E-Value=1.2e-24) Length = 691 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +3 Query: 327 PWKRHFYIYHTNIFPWRDSNPRPPCIVTMSLTTTPDGRL 443 PW +IY + + +R + P C V +++T D R+ Sbjct: 49 PWSAFIHIYRHHYYYYRQAMFSPECKVVLAITEPQDLRV 87 >SB_43085| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-08) Length = 532 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -1 Query: 133 SCLILYTCYNI-FIYRTNIFYIKNSNLICFC 44 S L+LYT + FIY T + I + +L+C C Sbjct: 154 SALVLYTASRLYFIYVTLVAVIADLSLVCVC 184 >SB_11434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 866 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 536 CEFLTFSLE*KLTPVWSLP 592 C F+TF L +TP+WS P Sbjct: 229 CAFVTFRLNDSVTPLWSKP 247 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,349,290 Number of Sequences: 59808 Number of extensions: 398099 Number of successful extensions: 850 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -