BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0590 (679 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016670-8|AAB66101.1| 783|Caenorhabditis elegans Hypothetical ... 30 1.3 Z71265-5|CAA95836.1| 481|Caenorhabditis elegans Hypothetical pr... 27 9.3 >AF016670-8|AAB66101.1| 783|Caenorhabditis elegans Hypothetical protein K02F6.1 protein. Length = 783 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 317 YIKYVYVYNKNLTFISVIWYLHTSSLR 237 Y +YVYV+N+N + W H+ +R Sbjct: 427 YTEYVYVWNRNNNLLGTSWMRHSPQMR 453 >Z71265-5|CAA95836.1| 481|Caenorhabditis elegans Hypothetical protein M05B5.6 protein. Length = 481 Score = 27.5 bits (58), Expect = 9.3 Identities = 9/41 (21%), Positives = 23/41 (56%) Frame = -1 Query: 193 YLLFIIYYKASKSYLSRN*QSCLILYTCYNIFIYRTNIFYI 71 + +F++ K+ ++++ + I+ C+NIF Y + Y+ Sbjct: 129 FFMFLVLKGTIKARITKSVSTWFIVAFCFNIFTYMATLAYV 169 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,679,852 Number of Sequences: 27780 Number of extensions: 307984 Number of successful extensions: 619 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -