BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0587 (711 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55200.1 68414.m06305 protein kinase family protein contains ... 32 0.43 At3g13690.1 68416.m01729 protein kinase family protein contains ... 31 0.75 At2g21630.1 68415.m02573 transport protein, putative similar to ... 31 1.00 At3g23920.1 68416.m03005 beta-amylase, putative / 1,4-alpha-D-gl... 29 3.0 At3g53930.1 68416.m05958 protein kinase family protein contains ... 28 7.0 >At1g55200.1 68414.m06305 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 676 Score = 31.9 bits (69), Expect = 0.43 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = +1 Query: 163 LFTVAALLGSCQSAHLNKHIKLLSDIDNSIEMVCKQNLMDLINIYRSRKAPYR 321 L+T G C + H H +S+I + + C Q ++ L ++Y K R Sbjct: 62 LWTFPRFAGDCATGHWKLHSDPMSEIKSDLTDTCSQMILQLHDVYDPNKVNVR 114 >At3g13690.1 68416.m01729 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 753 Score = 31.1 bits (67), Expect = 0.75 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 187 GSCQSAHLNKHIKLLSDIDNSIEMVCKQNLMDLINIYRSRK 309 G C S H H + L +I + + C Q ++ L ++Y K Sbjct: 78 GDCASGHRKSHSEALPEIKSDLTDTCSQMILQLHDVYDPNK 118 >At2g21630.1 68415.m02573 transport protein, putative similar to Swiss-Prot:Q15436 protein transport protein Sec23A [Homo sapiens] Length = 761 Score = 30.7 bits (66), Expect = 1.00 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 291 YLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFKNDS 413 Y S+ LP TT+E C++ SP+P V F D+ Sbjct: 95 YSSVADNNLPPELFPHSTTVEYLCDSFSSPSPPVFLFVVDT 135 >At3g23920.1 68416.m03005 beta-amylase, putative / 1,4-alpha-D-glucan maltohydrolase, putative similar to beta-amylase enzyme [Arabidopsis thaliana] GI:6065749, beta-amylase PCT-BMYI from [Solanum tuberosum]; contains Pfam profile PF01373: Glycosyl hydrolase family 14 Length = 575 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 578 YNTDSATELSERAKLFPLKPRIVVSYSTYVDNIGNRVVLP 697 YN EL E AK LK + V+S+ N+G+ V +P Sbjct: 161 YNWGGYNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIP 200 >At3g53930.1 68416.m05958 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 711 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +3 Query: 324 YAHTPGTTIELTCEAAGSPAPSVHWFKNDSPVYEYDVESNELIDSSPTSIA 476 Y G +++ ++GSP P + FK+ SP E+ ++ N ++P IA Sbjct: 421 YVLISGPPVDIPSSSSGSPKPFNYPFKSHSPPVEF-IKRNVTNLTAPMPIA 470 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,684,647 Number of Sequences: 28952 Number of extensions: 262653 Number of successful extensions: 649 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -