BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0585 (693 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 27 0.42 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 25 3.0 AF203338-1|AAF19833.1| 113|Anopheles gambiae immune-responsive ... 24 5.2 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 6.9 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 9.1 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 9.1 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 27.5 bits (58), Expect = 0.42 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +2 Query: 5 LQVQPVKVQMNYYHKQRSQLMTSQHQQEDQWMISHLKQKAH 127 +Q+QP++ + Q Q + Q QQ+ Q H + + H Sbjct: 1288 IQLQPIQQPLQTLQHQYQQQLQQQQQQQQQQQQQHQQHQQH 1328 Score = 23.4 bits (48), Expect = 6.9 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +2 Query: 14 QPVKVQMNYYHKQRSQLMTSQHQQEDQWMISHLKQKAH 127 QP++ + Y +Q Q Q QQ+ Q Q H Sbjct: 1295 QPLQTLQHQYQQQLQQQQQQQQQQQQQHQQHQQHQLQH 1332 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +2 Query: 29 QMNYYHKQRSQLMTSQHQQEDQWMISHLKQKAHLMIWK 142 Q H+QR Q Q QQ+ Q +Q+ W+ Sbjct: 224 QQQQQHQQREQQQQQQQQQQQQQQQQQQQQRNQQREWQ 261 >AF203338-1|AAF19833.1| 113|Anopheles gambiae immune-responsive trypsin-like serineprotease-related protein ISPR10 protein. Length = 113 Score = 23.8 bits (49), Expect = 5.2 Identities = 4/28 (14%), Positives = 18/28 (64%) Frame = +1 Query: 604 NVATNDSVTESKIKIVWPKRNTMNKNCI 687 N+ ++ ++ S ++++W ++ ++C+ Sbjct: 6 NLCSSQNIRSSTVRLIWSAQDDQQQSCV 33 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.4 bits (48), Expect = 6.9 Identities = 12/39 (30%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 8 QVQPVKVQMNYYHKQRSQLMTSQH-QQEDQWMISHLKQK 121 Q Q + Q +Q+ Q QH QQ+ QW +Q+ Sbjct: 339 QQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQ 377 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 44 HKQRSQLMTSQHQQEDQ 94 H ++ Q SQHQQ+ Q Sbjct: 470 HSEKQQQQQSQHQQQHQ 486 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 44 HKQRSQLMTSQHQQEDQ 94 H ++ Q SQHQQ+ Q Sbjct: 470 HSEKQQQQQSQHQQQHQ 486 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 700,076 Number of Sequences: 2352 Number of extensions: 13536 Number of successful extensions: 30 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -