BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0581 (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 2.3 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 23 4.0 AF213011-1|AAG43567.1| 62|Apis mellifera esterase A2 protein. 22 6.9 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 447 RLGLGLTQTQVGQALSVTEGPHIVKVRSADLRNW 548 R+GLG+T +S+ + KVR A +W Sbjct: 276 RVGLGITTVLTLSTISLDSRTDLPKVRYATALDW 309 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = -2 Query: 548 PISQICRSHFDYMRSFGDRQGLAYLGLRKSQTKSSQFEGLRE 423 PI IC+ + + S + + + + K++ + + E +RE Sbjct: 33 PICNICKRVYSSLNSLRNHKSIYHRQHSKNEQQRKEMEQMRE 74 >AF213011-1|AAG43567.1| 62|Apis mellifera esterase A2 protein. Length = 62 Score = 21.8 bits (44), Expect = 6.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 545 LDITPKSAQKIKPVLRTLDEGSRGKGTHS 631 LD+ S + KPV+ + EG+ GT S Sbjct: 7 LDVYTNSLDQSKPVMFYVHEGAFISGTSS 35 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,677 Number of Sequences: 438 Number of extensions: 4004 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -