BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0579 (715 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g37020.1 68414.m04616 Ulp1 protease family protein 33 0.19 At1g06530.1 68414.m00692 myosin heavy chain-related similar to m... 32 0.43 At1g34320.1 68414.m04259 expressed protein contains Pfam domain ... 30 1.8 At2g35110.1 68415.m04307 HEM protein-related weak similarity to ... 29 3.1 At1g19230.1 68414.m02393 respiratory burst oxidase protein E (Rb... 29 3.1 At4g10270.1 68417.m01688 wound-responsive family protein similar... 29 4.0 At4g31390.1 68417.m04452 ABC1 family protein contains Pfam domai... 28 5.3 At1g78270.1 68414.m09121 UDP-glucose glucosyltransferase, putati... 28 5.3 At1g02330.1 68414.m00178 expressed protein contains similarity t... 28 5.3 At5g18980.1 68418.m02255 expressed protein 27 9.3 At4g26050.1 68417.m03750 leucine-rich repeat family protein cont... 27 9.3 At3g17520.1 68416.m02238 late embryogenesis abundant domain-cont... 27 9.3 At1g09250.1 68414.m01033 expressed protein 27 9.3 >At1g37020.1 68414.m04616 Ulp1 protease family protein Length = 611 Score = 33.1 bits (72), Expect = 0.19 Identities = 22/83 (26%), Positives = 40/83 (48%) Frame = +3 Query: 279 EDEIATLRTVLQSKIRQSSDLKRKLGITVWKEITEDVNQGLKNVKESQVYQKTESVIKTT 458 EDE LQ KI+ ++ K+K + K+ ++ + + VKE +V T V+K T Sbjct: 253 EDETPNKELELQLKIKDATKGKKKKVAIMPKKASKIPKKKMAKVKEMKV--STPKVLKKT 310 Query: 459 AEKTSSIIGGITAGVSRSSVRCA 527 + +G +T V +++ A Sbjct: 311 MRRDDDYVGDVTEKVVADTLKMA 333 >At1g06530.1 68414.m00692 myosin heavy chain-related similar to myosin heavy chain (GI:1408194) {Placopecten magellanicus}; similar to Myosin heavy chain, clone 203 (Fragment) (SP:P39922){Hydra attenuata}; contains one transmembrane domain Length = 323 Score = 31.9 bits (69), Expect = 0.43 Identities = 19/78 (24%), Positives = 34/78 (43%) Frame = +3 Query: 267 LARVEDEIATLRTVLQSKIRQSSDLKRKLGITVWKEITEDVNQGLKNVKESQVYQKTESV 446 + +E E+A LRTV + ++ +L+ KLG KE+ E + + + E Sbjct: 146 IEELEKEVAGLRTVKEENEKRMKELESKLGALEVKELDEKNKKFRAEEEMREKIDNKEKE 205 Query: 447 IKTTAEKTSSIIGGITAG 500 + EK S+ + G Sbjct: 206 VHDLKEKIKSLESDVAKG 223 >At1g34320.1 68414.m04259 expressed protein contains Pfam domain PF05003: protein of unknown function (DUF668) Length = 657 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = +3 Query: 276 VEDEIATLRTVLQSKIRQSSDLKRKLGITVWKEITEDVNQGLKNV 410 V D +A LRT L+S+ + +LK+K ++W I E+V + L +V Sbjct: 308 VGDTLAILRTELKSQKKHVRNLKKK---SLWSRILEEVMEKLVDV 349 >At2g35110.1 68415.m04307 HEM protein-related weak similarity to Membrane-associated protein Hem (Dhem-2) (Swiss-Prot:P55162) [Drosophila melanogaster]; weak similarity to Nck-associated protein 1 (NAP 1) (p125Nap1) (Membrane-associated protein HEM-2) (Swiss-Prot:P55161) [Rattus norvegicus] Length = 1339 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 505 DTPAVMPPMIEDVFSAVVFITDSVFWY 425 D P+++ P I+ VFSA+ V WY Sbjct: 417 DQPSLLAPNIQMVFSALALAQSEVLWY 443 >At1g19230.1 68414.m02393 respiratory burst oxidase protein E (RbohE) / NADPH oxidase nearly identical to respiratory burst oxidase protein E GI:3242787 [gi:3242787] from [Arabidopsis thaliana] Length = 926 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +2 Query: 98 HSFHTVRVFHCKI*AVFKQLKKQCQ 172 H TV VF+C I V K+LKKQ Q Sbjct: 885 HPNSTVGVFYCGIQTVAKELKKQAQ 909 >At4g10270.1 68417.m01688 wound-responsive family protein similar to wound induced protein (GI:19320) [Lycopersicon esculentum] Length = 90 Score = 28.7 bits (61), Expect = 4.0 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = +3 Query: 339 LKRKLGITVWKEITEDVNQGLKNVKESQVYQKTESVIKTTAEKTSS 476 LK +LG+ W I VNQ L+N S K S +A TSS Sbjct: 20 LKDQLGLCRWNYILRSVNQHLRNNVRSVSQGKRFSSSSVSAAVTSS 65 >At4g31390.1 68417.m04452 ABC1 family protein contains Pfam domain, PF03109: ABC1 family Length = 682 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 527 NSESFRSIEERVGSAYENVKGKVASRSNSTQSFDEALR 640 N +F IEE +G EN+ K++S++ + S + R Sbjct: 215 NEVAFNIIEEELGQPLENIFSKISSQTIAAASLGQVYR 252 >At1g78270.1 68414.m09121 UDP-glucose glucosyltransferase, putative similar to UDP-glucose glucosyltransferase GI:3928543 from [Arabidopsis thaliana] Length = 489 Score = 28.3 bits (60), Expect = 5.3 Identities = 15/58 (25%), Positives = 33/58 (56%) Frame = +3 Query: 318 KIRQSSDLKRKLGITVWKEITEDVNQGLKNVKESQVYQKTESVIKTTAEKTSSIIGGI 491 +I ++S++ RKLG+ +W+E TE ++ +++ +Y S+ T+E+ G+ Sbjct: 265 EIDKNSEI-RKLGLNLWEEETESLDWLDTKAEKAVIYVNFGSLTVLTSEQILEFAWGL 321 >At1g02330.1 68414.m00178 expressed protein contains similarity to hepatocellular carcinoma-associated antigen 59 GI:7158847 from [Homo sapiens] Length = 279 Score = 28.3 bits (60), Expect = 5.3 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +3 Query: 264 ELARVEDEIATLRTVLQSKIRQSSDLKRKLGITVWKEITEDVNQGLKNVKESQVYQK 434 EL RVEDE+ + L+ K ++SS+ T E+ + LKN++E++ +K Sbjct: 126 ELKRVEDELYKIPDHLKVK-KRSSEESSTQWTTGIAEVQLPIEYKLKNIEETEAAKK 181 >At5g18980.1 68418.m02255 expressed protein Length = 835 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/53 (24%), Positives = 28/53 (52%) Frame = +3 Query: 357 ITVWKEITEDVNQGLKNVKESQVYQKTESVIKTTAEKTSSIIGGITAGVSRSS 515 + +W +++ + +E + ++ E V++TTAE + + T G+SR S Sbjct: 767 LAIWMMEDDELEDNVALFREMGLEKELEKVLETTAELENFDVFSGTVGLSRHS 819 >At4g26050.1 68417.m03750 leucine-rich repeat family protein contains Pfam PF00560: Leucine Rich Repeat domains; Length = 383 Score = 27.5 bits (58), Expect = 9.3 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +3 Query: 381 EDVNQGLKNVKESQVYQKTESVIKTTAEKTSSIIGGITA-GVSRSSVRCATR 533 E V QGL+ +K+ + TES KT +K S IG + G+S S R R Sbjct: 286 EVVEQGLEALKQYMSEKMTESYKKTPTKKKSWGIGKLVKYGLSSSPGRSTGR 337 >At3g17520.1 68416.m02238 late embryogenesis abundant domain-containing protein / LEA domain-containing protein low similarity to PIR|S04045|S04045 embryonic abundant protein D-29 [Gossypium hirsutum]; contains Pfam profile PF02987: Late embryogenesis abundant protein Length = 298 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 5/48 (10%) Frame = +2 Query: 506 QKLGQMRNSESFRSIEERVGSAYENVKGKV-----ASRSNSTQSFDEA 634 ++ + + E+ + +E+ GSAYE K KV + + ++QS+D A Sbjct: 80 KEAAKRKAEEAVGAAKEKAGSAYETAKSKVEEGLASVKDKASQSYDSA 127 >At1g09250.1 68414.m01033 expressed protein Length = 207 Score = 27.5 bits (58), Expect = 9.3 Identities = 17/70 (24%), Positives = 32/70 (45%) Frame = +2 Query: 392 SGFEKRQRKPSIPKN*ICDKNDRREDVFDHRRHHGRRVQKLGQMRNSESFRSIEERVGSA 571 +G R++KP I + + RR + +R RVQ++ + E+ R + +R + Sbjct: 12 TGESSRRKKPRISETAEAEIEARRVNEESLKRWKTNRVQQIYACKLVEALRRVRQRSSTT 71 Query: 572 YENVKGKVAS 601 N K+ S Sbjct: 72 SNNETDKLVS 81 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,506,530 Number of Sequences: 28952 Number of extensions: 258034 Number of successful extensions: 839 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -