BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0578 (722 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26177| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_34063| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_373| Best HMM Match : Somatomedin_B (HMM E-Value=3.5) 28 6.7 SB_54662| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_13031| Best HMM Match : TLD (HMM E-Value=0.18) 28 8.8 >SB_26177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = -1 Query: 398 QSTNSSLVYKSRRFVTKISSWTLSTRQFCSTNEHRG 291 +S+ + ++Y RR ++K ++STRQ+C ++E G Sbjct: 63 ESSWNRIIYVLRRSMSKCEYCSMSTRQYCKSSEGLG 98 >SB_34063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 886 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -2 Query: 421 IKRNAKRNKVQIVRSCIKADASLQKYHH 338 I+ N K NKV + S K DASL Y H Sbjct: 227 IENNVKHNKVDHIVSASKNDASLLMYQH 254 >SB_373| Best HMM Match : Somatomedin_B (HMM E-Value=3.5) Length = 404 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 169 HRYCHCS*HR*PLTISWREQRDPRALGVSVVC 264 H Y C H +W Q DPR LG C Sbjct: 96 HNYRRCPCHNYGRECNWINQPDPRCLGYCFTC 127 >SB_54662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 486 SVDVTTVAESIFSFYTEATWR 548 S+ + V E IF YTEA+WR Sbjct: 452 SITIIKVGEYIFGGYTEASWR 472 >SB_13031| Best HMM Match : TLD (HMM E-Value=0.18) Length = 175 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 486 SVDVTTVAESIFSFYTEATWR 548 S+ + V E IF YTEA+WR Sbjct: 59 SITIIKVGEYIFGGYTEASWR 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,815,128 Number of Sequences: 59808 Number of extensions: 458342 Number of successful extensions: 1113 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -