BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0575 (550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55856| Best HMM Match : TPR_2 (HMM E-Value=4.1e-14) 29 3.3 SB_55624| Best HMM Match : PHD (HMM E-Value=3.8) 28 4.4 >SB_55856| Best HMM Match : TPR_2 (HMM E-Value=4.1e-14) Length = 742 Score = 28.7 bits (61), Expect = 3.3 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = -1 Query: 484 TESFVATLTALEIICQPLC*IFPQQSTQ*LSNSHLSNYYVEALIYIIIHKRAMPLYL 314 TE + TLT + + +C + ST N+Y EAL+Y H + LYL Sbjct: 125 TEQTMNTLTKAKEVQTRICSEMAEISTASREYDKAINFYKEALVYDDTHIQCSKLYL 181 >SB_55624| Best HMM Match : PHD (HMM E-Value=3.8) Length = 349 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = +3 Query: 378 DKCELDNYCVLCCG----NI*HKGWQIISSAVNVATNDSVTESK 497 D+CEL Y + CCG ++ H+ W ++S V + V +SK Sbjct: 149 DECELHGYHMACCGILGEDVRHQ-WSRVASQGKVPLLEQVEQSK 191 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,727,758 Number of Sequences: 59808 Number of extensions: 265193 Number of successful extensions: 442 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 442 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -