BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0571 (754 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 28 0.36 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 7.7 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 27.9 bits (59), Expect = 0.36 Identities = 24/73 (32%), Positives = 32/73 (43%) Frame = +3 Query: 315 RRRRSVGRLTKPANDQPVFQQRSRWDQLRRHQGIREGLQTATTWSGTYADPSRPSPVGHR 494 RRR S G T + +QQ+ + QL H G RE + T P+ P+P Sbjct: 136 RRRHSFGTSTHRHHLPQQYQQQQQQHQL-EHNGGREQMMKNET--SIDEVPNAPAPKAPC 192 Query: 495 RPAYSKVRSADLR 533 +PA S S LR Sbjct: 193 QPAGSTSDSGTLR 205 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 324 RSVGRLTKPANDQPVFQQRSR 386 RSV R+ D P+F +R+R Sbjct: 1324 RSVARIVTSFTDSPLFSRRNR 1344 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 751,806 Number of Sequences: 2352 Number of extensions: 14278 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -