BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0570 (634 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.5 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 3.3 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 9.9 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 2.5 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = -3 Query: 422 CSKFFRLNGVLFSEQLTEFVHLLA*FVTLVLRQCALYSSILVSVSCSTASAW 267 CS +F GV+ S +++++ L+A ++ VL L +L V + AW Sbjct: 976 CSDYFSQGGVIESIMVSDYLPLVAATLSGVL--VLLVIIVLAFVFRESVGAW 1025 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 60 PRGAGGMPTS 31 PRG GG+PTS Sbjct: 399 PRGPGGVPTS 408 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.0 bits (42), Expect = 9.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 321 ALPQDECDKLREEMN 365 AL QD KLREE+N Sbjct: 321 ALNQDVQKKLREEIN 335 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,884 Number of Sequences: 438 Number of extensions: 1985 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -