BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0567 (723 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 3.3 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 5.8 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 7.6 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 7.6 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 21 7.6 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 119 NMFANLFKGLFGKKEMRILMVGLDAA 196 N+FA+ F +FGK +I++ G A Sbjct: 384 NIFASYFAYIFGKFACKIMIQGFSYA 409 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 119 NMFANLFKGLFGKKEMRILMVGLDAA 196 N+FA+ F +FGK +I++ G A Sbjct: 384 NIFASYFAYIFGKFACKIMIQGFSYA 409 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 119 NMFANLFKGLFGKKEMRILMVGLDAA 196 N+FA+ F +FGK +I++ G A Sbjct: 384 NIFASYFAYIFGKFACKIMIQGFSYA 409 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 119 NMFANLFKGLFGKKEMRILMVGLDAA 196 N+FA+ F +FGK +I++ G A Sbjct: 384 NIFASYFAYIFGKFACKIMIQGFSYA 409 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.6 bits (46), Expect = 3.3 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 241 NNNSHIGF--NVETVEYKNISFTVWDVGGQDKIRPL 342 +N S +G +E + KNI TV + G K++PL Sbjct: 529 SNTSLLGAANQLEELNLKNIDLTVLESGAFCKMQPL 564 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 686 FVCELAHIRLAVGVLEL 636 F+C+LA LAVG++ + Sbjct: 84 FICQLAIADLAVGLISV 100 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 74 ELEKKRNTNEFLTIR 30 ELEK+ +TN +LT R Sbjct: 237 ELEKEFHTNHYLTRR 251 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.4 bits (43), Expect = 7.6 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 210 IVVLPAASKPTINILISFLPKRPLNKFAN 124 +V L S I ++ISF+ K+ F N Sbjct: 85 VVSLSGNSAVFIMLIISFMHKKSFKNFVN 113 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 74 ELEKKRNTNEFLTIR 30 ELEK+ +TN +LT R Sbjct: 19 ELEKEFHTNHYLTRR 33 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,253 Number of Sequences: 336 Number of extensions: 4277 Number of successful extensions: 12 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -