BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0566 (657 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP22H7.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 27 3.1 SPBC31F10.13c |hip1|hir1|hira protein Hip1|Schizosaccharomyces p... 26 4.2 SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pomb... 25 7.3 SPBC21.04 |med8|sep15|mediator complex subunit Med8|Schizosaccha... 25 9.6 SPAC57A7.13 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 25 9.6 >SPBP22H7.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 255 Score = 26.6 bits (56), Expect = 3.1 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Frame = +3 Query: 114 ILVFKILNAQKTSKLDSQQILF-ITSKRKY----LSWQSIRDYEPFLFF 245 I + ++ N K + IL ITSKR ++WQ++ EPFL + Sbjct: 43 ISILRVFNKPPIKKFHNSNILKDITSKRNATPAKIAWQAMTTREPFLVY 91 >SPBC31F10.13c |hip1|hir1|hira protein Hip1|Schizosaccharomyces pombe|chr 2|||Manual Length = 932 Score = 26.2 bits (55), Expect = 4.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 472 SYVVWSTSFCRPRLQCQQLYLKLI 543 S +WS++ RP L CQ ++ K I Sbjct: 302 SLSIWSSALPRPLLSCQNVFQKSI 325 >SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pombe|chr 1|||Manual Length = 1778 Score = 25.4 bits (53), Expect = 7.3 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = +2 Query: 392 PTFG----GALSPGRNSTAMPGGAPPSMASRATLFGQ 490 P FG G L RN+T GG M+S +FGQ Sbjct: 57 PLFGSNTNGGLFGNRNNTTTTGGTGFGMSSGTGMFGQ 93 >SPBC21.04 |med8|sep15|mediator complex subunit Med8|Schizosaccharomyces pombe|chr 2|||Manual Length = 200 Score = 25.0 bits (52), Expect = 9.6 Identities = 14/56 (25%), Positives = 31/56 (55%) Frame = +1 Query: 148 HQNWTVNKSCLLHRSGNIYLGRVYAIMNHSYSL*NSEQGLIIGYGKLEFSTSASKP 315 HQ+ +++ +H++ NI L +++++ N+ + ++ Q I Y LEF +P Sbjct: 35 HQSESLSPWPTIHKNFNILLSQIHSLSNNLAAHSHTLQTTSI-YPSLEFPVKEQEP 89 >SPAC57A7.13 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 565 Score = 25.0 bits (52), Expect = 9.6 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -1 Query: 651 GPEVVVLMCHHLHQKLNGSCCQR*TVTDYSY 559 G +V V +++ G CCQ + +YSY Sbjct: 141 GIDVSVRFSRAAREQIEGWCCQNCDILNYSY 171 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,437,905 Number of Sequences: 5004 Number of extensions: 43379 Number of successful extensions: 94 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -