BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0564 (424 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 3.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 3.7 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 6.5 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 20 8.6 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 3.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 261 FRSEFPLKIPMSDVEFPS 208 FRS +P +P+S PS Sbjct: 202 FRSPYPSALPISTSSLPS 219 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 3.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 261 FRSEFPLKIPMSDVEFPS 208 FRS +P +P+S PS Sbjct: 94 FRSPYPSALPISTSSLPS 111 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +3 Query: 9 FGEICEFDVNEVFSLVFSDQVPNCVD 86 + E+CEF N + + +VP D Sbjct: 293 YNELCEFHKNGIIEWDDTQKVPYLYD 318 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 20.2 bits (40), Expect = 8.6 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +2 Query: 110 YFRHSQILSLKNLLDIVGFRLVGLSNRSQN 199 Y +L LKN I+ RL+ + ++Q+ Sbjct: 819 YLATELVLMLKNRYIILNGRLIKMETKAQS 848 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,539 Number of Sequences: 336 Number of extensions: 2341 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9384961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -