BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0564 (424 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 27 0.21 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 27 0.37 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 27 0.37 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 27 0.37 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 25 1.1 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 3.5 AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 23 4.6 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 23 4.6 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 23 6.0 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 27.5 bits (58), Expect = 0.21 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +1 Query: 244 WKLTPELADLIAIRLCVRKGGCSVYHKTNIETIVEIAESIRG 369 +KL ++ I+ C+RK C++YH E + +S+ G Sbjct: 92 YKLEKFNYNIARIQACLRKLNCTLYHPKQREEFSPVLQSMSG 133 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 26.6 bits (56), Expect = 0.37 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 244 WKLTPELADLIAIRLCVRKGGCSVYHKTNIETIVEIAESIRG 369 +KL ++ I+ C+RK C++YH E + S+ G Sbjct: 58 YKLEKFNYNIARIQACLRKLNCTLYHPKQREEFSPVLRSMSG 99 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 26.6 bits (56), Expect = 0.37 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 244 WKLTPELADLIAIRLCVRKGGCSVYHKTNIETIVEIAESIRG 369 +KL ++ I+ C+RK C++YH E + S+ G Sbjct: 58 YKLEKFNYNIARIQACLRKLNCTLYHPKQREEFSPVLRSMSG 99 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 26.6 bits (56), Expect = 0.37 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 244 WKLTPELADLIAIRLCVRKGGCSVYHKTNIETIVEIAESIRG 369 +KL ++ I+ C+RK C++YH E + S+ G Sbjct: 58 YKLEKFNYNIARIQACLRKLNCTLYHPKQREEFSPVLRSMSG 99 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 25.0 bits (52), Expect = 1.1 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = +1 Query: 241 EWKLTPELADLIAIRLCVRKGGCSVYHKTNIETIVEIAE 357 EW + I L +R G +H+ I+ +VE+ + Sbjct: 335 EWAKYSNYDAAVRIPLVIRAPGMQTHHQQKIDNVVELLD 373 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.4 bits (48), Expect = 3.5 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +1 Query: 52 WFFQIKYLTA*TFNCLLNKLFSTFTNII 135 WF + T + CL N TF N I Sbjct: 136 WFNMVNETTCMNYECLRNDANETFINSI 163 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 23.0 bits (47), Expect = 4.6 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 16 KYVSLM*MKYFLWFFQIKYLTA*TFNCLLNKLFSTFTNIIIKKPSGY 156 K+VS++ ++FLW F T +C +F TF II + PS Y Sbjct: 455 KFVSMVLDRFFLWVF--------TISC----IFGTF-GIIFQSPSLY 488 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.0 bits (47), Expect = 4.6 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = -3 Query: 404 SLVPVCMI*IFLPRIDSAISTMVSMLVLW 318 SL+ CM+ + L I + +++++ LW Sbjct: 56 SLMTPCMVIVMLSYIFGCVGNLMALIHLW 84 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 22.6 bits (46), Expect = 6.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 16 KYVSLM*MKYFLWFFQI 66 KYV+L+ + FLW F I Sbjct: 496 KYVALVLDRLFLWIFTI 512 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 442,671 Number of Sequences: 2352 Number of extensions: 7995 Number of successful extensions: 18 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -