BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0561 (706 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC23G7.12c |rpt6|let1|19S proteasome regulatory subunit Rpt6|S... 26 4.6 SPAC19A8.01c |sec73|sec7c, SPAC23H3.01|guanyl-nucleotide exchang... 26 6.0 SPAC227.12 |||U4/U6 x U5 tri-snRNP complex subunit Prp4 family|S... 25 8.0 >SPBC23G7.12c |rpt6|let1|19S proteasome regulatory subunit Rpt6|Schizosaccharomyces pombe|chr 2|||Manual Length = 403 Score = 26.2 bits (55), Expect = 4.6 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +2 Query: 257 YLVEYQHLLERQDIKVRHVLALYLRSYELTNTVPFNVDALTNGQPIEQHP 406 Y+V+ ++ ++IK +AL SY+L +P VD L + +E+ P Sbjct: 91 YVVDISPDIDIKEIKPNIRVALRNDSYQLIKILPNKVDPLVSLMMVEKIP 140 >SPAC19A8.01c |sec73|sec7c, SPAC23H3.01|guanyl-nucleotide exchange factor Sec73 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1082 Score = 25.8 bits (54), Expect = 6.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 541 RTETSKRSSGHNPFHERRRALTAS 612 R E +RS GHN + E LTAS Sbjct: 624 RCEKKRRSVGHNSYKEHLVLLTAS 647 >SPAC227.12 |||U4/U6 x U5 tri-snRNP complex subunit Prp4 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 462 Score = 25.4 bits (53), Expect = 8.0 Identities = 19/46 (41%), Positives = 23/46 (50%) Frame = +2 Query: 290 QDIKVRHVLALYLRSYELTNTVPFNVDALTNGQPIEQHPTEKDVEG 427 +D KVR YLR Y T F DAL Q ++Q EK +EG Sbjct: 49 EDSKVRE----YLRRYGEPITY-FGEDALARRQRLQQLMIEKSLEG 89 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,920,492 Number of Sequences: 5004 Number of extensions: 58492 Number of successful extensions: 171 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 171 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -