BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0558 (451 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 81 3e-16 At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri... 77 7e-15 At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri... 77 7e-15 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 76 1e-14 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 74 4e-14 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 65 2e-11 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 55 3e-08 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 54 3e-08 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 48 3e-06 At3g55640.1 68416.m06182 mitochondrial substrate carrier family ... 47 5e-06 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 47 5e-06 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 47 7e-06 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 44 4e-05 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 44 4e-05 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 44 5e-05 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 43 8e-05 At5g64970.1 68418.m08172 mitochondrial substrate carrier family ... 41 3e-04 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 41 3e-04 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 40 8e-04 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 38 0.003 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 38 0.003 At2g46320.1 68415.m05761 mitochondrial substrate carrier family ... 37 0.005 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 36 0.010 At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 36 0.010 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 36 0.010 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 36 0.013 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 36 0.013 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 36 0.013 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 36 0.017 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 34 0.051 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 33 0.067 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 33 0.067 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 33 0.067 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 33 0.12 At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) id... 33 0.12 At4g27940.1 68417.m04009 mitochondrial substrate carrier family ... 31 0.27 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 31 0.36 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 31 0.36 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 31 0.48 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 31 0.48 At2g47490.1 68415.m05928 mitochondrial substrate carrier family ... 30 0.63 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 30 0.63 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 30 0.83 At4g39460.1 68417.m05583 mitochondrial substrate carrier family ... 29 1.5 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 29 1.9 At4g24570.1 68417.m03521 mitochondrial substrate carrier family ... 29 1.9 At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (D... 28 2.5 At3g57540.1 68416.m06407 remorin family protein contains Pfam do... 28 3.4 At5g26200.1 68418.m03118 mitochondrial substrate carrier family ... 27 4.4 At5g15640.1 68418.m01830 mitochondrial substrate carrier family ... 27 4.4 At2g30160.1 68415.m03670 mitochondrial substrate carrier family ... 27 5.9 At5g58440.1 68418.m07319 phox (PX) domain-containing protein sim... 27 7.7 At5g27820.1 68418.m03335 ribosomal protein L18 family protein si... 27 7.7 At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 27 7.7 At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 27 7.7 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 27 7.7 At2g17090.1 68415.m01973 protein kinase family protein similar t... 27 7.7 At1g07980.1 68414.m00869 histone-like transcription factor (CBF/... 27 7.7 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 81.4 bits (192), Expect = 3e-16 Identities = 41/66 (62%), Positives = 48/66 (72%), Gaps = 1/66 (1%) Frame = +3 Query: 255 AAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 431 AAVSKTA APIERVKLL+Q Q + K + YKGI D F R K++G+L+ WRGN AN Sbjct: 90 AAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEGMLALWRGNTAN 149 Query: 432 VIRYFP 449 VIRYFP Sbjct: 150 VIRYFP 155 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 348 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 +YK + AF +I K +G S ++G AN++R Sbjct: 321 KYKSSLQAFSQIVKNEGAKSLFKGAGANILR 351 >At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 76.6 bits (180), Expect = 7e-15 Identities = 41/66 (62%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Frame = +3 Query: 255 AAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 431 AAVSKTA APIERVKLL+Q Q + K + YKGI D F R K++G S WRGN AN Sbjct: 91 AAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTAN 150 Query: 432 VIRYFP 449 VIRYFP Sbjct: 151 VIRYFP 156 Score = 31.1 bits (67), Expect = 0.36 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 348 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 +YK +DAF +I K +G S ++G AN++R Sbjct: 323 KYKSSLDAFKQILKNEGAKSLFKGAGANILR 353 >At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 76.6 bits (180), Expect = 7e-15 Identities = 41/66 (62%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Frame = +3 Query: 255 AAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 431 AAVSKTA APIERVKLL+Q Q + K + YKGI D F R K++G S WRGN AN Sbjct: 91 AAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTAN 150 Query: 432 VIRYFP 449 VIRYFP Sbjct: 151 VIRYFP 156 Score = 31.1 bits (67), Expect = 0.36 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 348 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 +YK +DAF +I K +G S ++G AN++R Sbjct: 323 KYKSSLDAFKQILKNEGAKSLFKGAGANILR 353 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 75.8 bits (178), Expect = 1e-14 Identities = 40/66 (60%), Positives = 47/66 (71%), Gaps = 1/66 (1%) Frame = +3 Query: 255 AAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 431 AAVSKTA APIERVKLL+Q Q + K + YKGI D F R +++G+ S WRGN AN Sbjct: 95 AAVSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTAN 154 Query: 432 VIRYFP 449 VIRYFP Sbjct: 155 VIRYFP 160 Score = 31.1 bits (67), Expect = 0.36 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 348 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 +YK DAF +I K++G S ++G AN++R Sbjct: 327 KYKSSFDAFSQIVKKEGAKSLFKGAGANILR 357 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 74.1 bits (174), Expect = 4e-14 Identities = 39/66 (59%), Positives = 48/66 (72%), Gaps = 1/66 (1%) Frame = +3 Query: 255 AAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 431 A V+K+A APIERVKLLLQ Q + K + Y G+ + F RI +E+G+LSFWRGN AN Sbjct: 21 AIVAKSAAAPIERVKLLLQNQGEMIKTGHLIRPYTGLGNCFTRIYREEGVLSFWRGNQAN 80 Query: 432 VIRYFP 449 VIRYFP Sbjct: 81 VIRYFP 86 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 65.3 bits (152), Expect = 2e-11 Identities = 33/72 (45%), Positives = 45/72 (62%), Gaps = 6/72 (8%) Frame = +3 Query: 252 LAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ------RYKGIVDAFVRIPKEQGLLSFW 413 + V T VAPIER KLLLQ Q + I D+ R+KG+ D R +E+G+LS W Sbjct: 40 MGGVVHTIVAPIERAKLLLQTQESNIAIVGDEGHAGKRRFKGMFDFIFRTVREEGVLSLW 99 Query: 414 RGNFANVIRYFP 449 RGN ++V+RY+P Sbjct: 100 RGNGSSVLRYYP 111 Score = 29.9 bits (64), Expect = 0.83 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +3 Query: 351 YKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 Y+ +D + +I + +GL SF+RG +N+ R Sbjct: 278 YRSTLDCWKKIYRSEGLASFYRGALSNMFR 307 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 54.8 bits (126), Expect = 3e-08 Identities = 23/64 (35%), Positives = 38/64 (59%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 A +KT AP++R+KLL+Q + + ++ G ++A I KE+G+ +W+GN VI Sbjct: 99 AAAKTVTAPLDRIKLLMQTHGIRLGQQSAKKAIGFIEAITLIAKEEGVKGYWKGNLPQVI 158 Query: 438 RYFP 449 R P Sbjct: 159 RVLP 162 Score = 28.3 bits (60), Expect = 2.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 351 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 449 YK I +AF I GL+ +RG N ++ P Sbjct: 312 YKSIPEAFAGIIDRDGLIGLYRGFLPNALKTLP 344 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 54.4 bits (125), Expect = 3e-08 Identities = 23/67 (34%), Positives = 39/67 (58%) Frame = +3 Query: 249 YLAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFA 428 + A +K+ AP++R+KLL+Q V + ++ G ++A I KE+G+ +W+GN Sbjct: 124 FAGAAAKSVTAPLDRIKLLMQTHGVRAGQQSAKKAIGFIEAITLIGKEEGIKGYWKGNLP 183 Query: 429 NVIRYFP 449 VIR P Sbjct: 184 QVIRIVP 190 Score = 28.7 bits (61), Expect = 1.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 351 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 449 YK ++DAF I +G++ +RG N ++ P Sbjct: 340 YKSVLDAFSGIIAREGVVGLYRGFVPNALKSMP 372 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 48.0 bits (109), Expect = 3e-06 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = +3 Query: 261 VSKTAVAPIERVKLLLQVQHVS-KQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 ++KTAVAP+ER+K+L Q + K+I G+V + +I K +GL+ F+RGN A+V Sbjct: 30 IAKTAVAPLERIKILFQTRRDEFKRI-------GLVGSINKIGKTEGLMGFYRGNGASVA 82 Query: 438 RYFP 449 R P Sbjct: 83 RIVP 86 Score = 34.3 bits (75), Expect = 0.039 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 282 PIERVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 449 P++ V+ L Q K I +Q Y+GIVD F R +E G +RG ++ FP Sbjct: 133 PLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFP 189 >At3g55640.1 68416.m06182 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 332 Score = 47.2 bits (107), Expect = 5e-06 Identities = 25/64 (39%), Positives = 34/64 (53%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 A SKT AP+ R+ +L QVQ + AA R I+ RI E+GL +FW+GN + Sbjct: 46 AFSKTCTAPLSRLTILFQVQGMHTNAAA-LRKPSILHEASRILNEEGLKAFWKGNLVTIA 104 Query: 438 RYFP 449 P Sbjct: 105 HRLP 108 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 47.2 bits (107), Expect = 5e-06 Identities = 25/64 (39%), Positives = 40/64 (62%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 A++KTAVAP+ER+K+LLQ + D + G+ + ++ + G L F++GN A+VI Sbjct: 35 AIAKTAVAPLERIKILLQTR------TNDFKTLGVSQSLKKVLQFDGPLGFYKGNGASVI 88 Query: 438 RYFP 449 R P Sbjct: 89 RIIP 92 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 46.8 bits (106), Expect = 7e-06 Identities = 26/63 (41%), Positives = 37/63 (58%) Frame = +3 Query: 261 VSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 VS+TAVAP+ER+K+LLQVQ+ + +Y G V I + +GL ++GN N R Sbjct: 51 VSRTAVAPLERMKILLQVQN-----PHNIKYSGTVQGLKHIWRTEGLRGLFKGNGTNCAR 105 Query: 441 YFP 449 P Sbjct: 106 IVP 108 Score = 28.7 bits (61), Expect = 1.9 Identities = 17/63 (26%), Positives = 33/63 (52%) Frame = +3 Query: 261 VSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 ++ +A P++ V+ L VQ + + +Y+GI A + +E+G + +RG +VI Sbjct: 154 IAMSATYPMDMVRGRLTVQTAN----SPYQYRGIAHALATVLREEGPRALYRGWLPSVIG 209 Query: 441 YFP 449 P Sbjct: 210 VVP 212 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 339 ADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 449 A Y G+VDAF + + +G + ++G N ++ P Sbjct: 292 ASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVP 328 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 44.4 bits (100), Expect = 4e-05 Identities = 24/64 (37%), Positives = 40/64 (62%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 AVS+TA AP++R+K++LQVQ + + G++ +I +E L+ F+RGN NV+ Sbjct: 217 AVSRTATAPLDRLKVVLQVQ---------RAHAGVLPTIKKIWREDKLMGFFRGNGLNVM 267 Query: 438 RYFP 449 + P Sbjct: 268 KVAP 271 Score = 26.6 bits (56), Expect = 7.7 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +3 Query: 312 VQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 449 +Q V ++ AD + F+ K +GL F+RG N+++ P Sbjct: 415 LQVVRTRMQADSSKTTMKQEFMNTMKGEGLRGFYRGLLPNLLKVVP 460 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 44.4 bits (100), Expect = 4e-05 Identities = 24/64 (37%), Positives = 33/64 (51%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 A SKT AP+ R+ +L Q+Q + + AA I RI KE+G +FW+GN V Sbjct: 81 AFSKTCTAPLARLTILFQIQGMQSE-AAILSSPNIWHEASRIVKEEGFRAFWKGNLVTVA 139 Query: 438 RYFP 449 P Sbjct: 140 HRLP 143 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 44.0 bits (99), Expect = 5e-05 Identities = 26/64 (40%), Positives = 37/64 (57%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 AVS+TA AP++R+K+ LQVQ + G+V +I +E LL F+RGN NV Sbjct: 216 AVSRTATAPLDRLKVALQVQRTN---------LGVVPTIKKIWREDKLLGFFRGNGLNVA 266 Query: 438 RYFP 449 + P Sbjct: 267 KVAP 270 Score = 27.1 bits (57), Expect = 5.9 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 312 VQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 449 +Q + ++ AD + F++ + +GL F+RG F N + P Sbjct: 414 LQVIRTRMQADSSKTSMGQEFLKTLRGEGLKGFYRGIFPNFFKVIP 459 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 43.2 bits (97), Expect = 8e-05 Identities = 23/64 (35%), Positives = 35/64 (54%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 A+SKT AP+ R+ +L Q+Q + + A R +A RI E+G +FW+GN V+ Sbjct: 53 AISKTCTAPLARLTILFQLQGMQSEGAVLSRPNLRREAS-RIINEEGYRAFWKGNLVTVV 111 Query: 438 RYFP 449 P Sbjct: 112 HRIP 115 >At5g64970.1 68418.m08172 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 428 Score = 41.1 bits (92), Expect = 3e-04 Identities = 21/67 (31%), Positives = 39/67 (58%) Frame = +3 Query: 249 YLAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFA 428 + A VS+T +AP+ER+KL +++ + +Q +++ RI +G+ FW+GN Sbjct: 140 FAAMVSRTCIAPLERMKL----EYI---VRGEQG--NLLELIQRIATNEGIRGFWKGNLV 190 Query: 429 NVIRYFP 449 N++R P Sbjct: 191 NILRTAP 197 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 41.1 bits (92), Expect = 3e-04 Identities = 23/64 (35%), Positives = 37/64 (57%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 A S+TA AP++R+K+LLQ+Q +I +A I K+ G+ F+RGN N++ Sbjct: 220 AASRTATAPLDRLKVLLQIQKTDARIR---------EAIKLIWKQGGVRGFFRGNGLNIV 270 Query: 438 RYFP 449 + P Sbjct: 271 KVAP 274 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 39.9 bits (89), Expect = 8e-04 Identities = 27/65 (41%), Positives = 35/65 (53%) Frame = +3 Query: 255 AAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANV 434 A VSKT +AP+ER+KL V+ +QR +V I QGL FW+GN NV Sbjct: 59 AMVSKTFLAPLERLKLEYTVR-------GEQRNLLVVAK--SIATTQGLTGFWKGNLLNV 109 Query: 435 IRYFP 449 +R P Sbjct: 110 LRTAP 114 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 37.9 bits (84), Expect = 0.003 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 8/71 (11%) Frame = +3 Query: 261 VSKTAVAPIERVKLLLQVQH--------VSKQIAADQRYKGIVDAFVRIPKEQGLLSFWR 416 VS++ +P++ +K+ QVQ V ++ +Y G+V A I +E+G FWR Sbjct: 31 VSRSVTSPLDVIKIRFQVQLEPTTSWGLVRGNLSGASKYTGMVQATKDIFREEGFRGFWR 90 Query: 417 GNFANVIRYFP 449 GN ++ P Sbjct: 91 GNVPALLMVMP 101 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 37.9 bits (84), Expect = 0.003 Identities = 16/66 (24%), Positives = 32/66 (48%) Frame = +3 Query: 249 YLAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFA 428 + +++ +P + VK+ +Q RY G ++AF +I + +G+ W+G Sbjct: 123 FSGVIAQVVASPADLVKVRMQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLP 182 Query: 429 NVIRYF 446 N+ R F Sbjct: 183 NIQRAF 188 >At2g46320.1 68415.m05761 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 361 Score = 37.1 bits (82), Expect = 0.005 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +3 Query: 324 SKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 449 S + +D +YKG +D F +I +++G WRG A++ P Sbjct: 91 SASVCSDNQYKGTLDVFYKIIRQEGFSRLWRGTNASLTLAIP 132 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 36.3 bits (80), Expect = 0.010 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +3 Query: 282 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 449 P + VK L Q S+ RYKG+V A I E+GL++ WRG ++R P Sbjct: 230 PFDVVKTRLMAQ--SRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLPRLMRIPP 283 Score = 29.9 bits (64), Expect = 0.83 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 276 VAPIERVKLLLQVQH-VSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 V P E VK+ LQ Q +S ++ +YKG + I +E+ +L W G V+R Sbjct: 126 VTPFEVVKIRLQQQKGLSPELF---KYKGPIHCARTIVREESILGLWSGAAPTVMR 178 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 36.3 bits (80), Expect = 0.010 Identities = 36/115 (31%), Positives = 49/115 (42%), Gaps = 4/115 (3%) Frame = +2 Query: 74 RNYSKSPVQKSGVSVS*SPIRVCRNSHLDIFT**RSHNRTKCRTSPIRS-RSLRTSWLAV 250 R S+SPV+ S SVS SPIR+ R S I +R SP+R R + S + Sbjct: 593 RRISRSPVRSSRKSVSRSPIRLSRRS---ISRSPIRLSRRSISRSPVRGRRRISRSPVPA 649 Query: 251 SRRRLQDRR---STHRACQAAAPSTARQQADRRRPALQGYRRRLRAHPQGAGSPF 406 RR ++ R R+ +A R + R Y RR R P SP+ Sbjct: 650 RRRSVRPRSPPPDRRRSLSRSASPNGRIRRGRGFSQRFSYARRYRTSPSPDRSPY 704 Score = 29.5 bits (63), Expect = 1.1 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 4/92 (4%) Frame = +2 Query: 74 RNYSKSPVQKSGVSVS*SPIRVCRNSHLDIFT**RSHNRTKCRTSPIRS--RSLRTSWLA 247 R+ S+SPV+ S S+S SPI++ R S T R R+ R SPIRS +S+ S + Sbjct: 521 RSPSRSPVRSSRRSLSRSPIQLSRRSLSRSPT--RLSRRSLSR-SPIRSPRKSVSRSPVR 577 Query: 248 VSRRRLQDR--RSTHRACQAAAPSTARQQADR 337 SR+ + RS+ R + ++R+ R Sbjct: 578 SSRKSVSRSPVRSSRRRISRSPVRSSRKSVSR 609 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 36.3 bits (80), Expect = 0.010 Identities = 18/69 (26%), Positives = 32/69 (46%) Frame = +3 Query: 234 LPGWRYLAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 413 +P + A+ + P E VK +Q+Q + +RY +D V+ K G+ + Sbjct: 117 VPSAMFGGAIISFVLCPTELVKCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIF 176 Query: 414 RGNFANVIR 440 RG A ++R Sbjct: 177 RGGSATLLR 185 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 35.9 bits (79), Expect = 0.013 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 345 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 + YK +VDA RI +++G+ S WRG++ V R Sbjct: 187 RNYKSVVDAIDRIARQEGVSSLWRGSWLTVNR 218 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 35.9 bits (79), Expect = 0.013 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 6/70 (8%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQ------HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 419 A+S+ +P++ +K+ QVQ K +Y G+ I +E+GL FWRG Sbjct: 27 AISRMVTSPLDVIKIRFQVQLEPTATWALKDSQLKPKYNGLFRTTKDIFREEGLSGFWRG 86 Query: 420 NFANVIRYFP 449 N ++ P Sbjct: 87 NVPALLMVVP 96 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 35.9 bits (79), Expect = 0.013 Identities = 20/64 (31%), Positives = 33/64 (51%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 A++ T V P++ +K LQV + + A+ QR I+ + I KE+G +RG +I Sbjct: 29 AIAATFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTII 88 Query: 438 RYFP 449 P Sbjct: 89 ALLP 92 Score = 32.3 bits (70), Expect = 0.16 Identities = 15/56 (26%), Positives = 30/56 (53%) Frame = +3 Query: 282 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 449 P E ++ LQ Q + A+ +Y G++D ++ + +G+ +RG N++R P Sbjct: 237 PHEVIRAKLQEQGQIRN--AETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTP 290 Score = 26.6 bits (56), Expect = 7.7 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 419 A + A P+ VK L Q + + YK ++ AF RI E+G+ + G Sbjct: 129 AATSIATNPLWVVKTRLMTQGIRPGVVP---YKSVMSAFSRICHEEGVRGLYSG 179 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 35.5 bits (78), Expect = 0.017 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +3 Query: 249 YLAAVSKTAVAPIERVKLLLQVQHVSKQIAAD---QRYKGIVDAFVRIPKEQGLLSFWRG 419 + A V + P++ K+ LQ+Q +A D +Y+G++ I +E+GL S W+G Sbjct: 20 FAACVGEVCTIPLDTAKVRLQLQ--KSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKG 77 Score = 33.1 bits (72), Expect = 0.089 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +3 Query: 282 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 P + VK+ LQ + A +RY G ++A+ I +++G+ + W G NV R Sbjct: 134 PTDLVKVRLQAEG-KLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVAR 185 Score = 30.3 bits (65), Expect = 0.63 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 324 SKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 431 S+ + YKG +D FV+ K G ++F++G N Sbjct: 240 SRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPN 275 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 33.9 bits (74), Expect = 0.051 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +3 Query: 255 AAVSKTAVA-PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 431 A VS+T + P+E VK L +Q YKGI DAF++I +E+G +RG + Sbjct: 214 AGVSQTLLTYPLELVKTRLTIQRGV--------YKGIFDAFLKIIREEGPTELYRGLAPS 265 Query: 432 VIRYFP 449 +I P Sbjct: 266 LIGVVP 271 Score = 33.5 bits (73), Expect = 0.067 Identities = 19/64 (29%), Positives = 36/64 (56%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 A+S TA P+E + +QV VS ++ YK ++ A V I + +G+L +++G + + Sbjct: 310 ALSSTATFPLEVARKHMQVGAVSGRVV----YKNMLHALVTILEHEGILGWYKGLGPSCL 365 Query: 438 RYFP 449 + P Sbjct: 366 KLVP 369 Score = 32.7 bits (71), Expect = 0.12 Identities = 22/64 (34%), Positives = 29/64 (45%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 AVS+T VAP+E ++ L V + F I K +G +RGN NVI Sbjct: 122 AVSRTVVAPLETIRTHLMVGSGGNSST---------EVFSDIMKHEGWTGLFRGNLVNVI 172 Query: 438 RYFP 449 R P Sbjct: 173 RVAP 176 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 33.5 bits (73), Expect = 0.067 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 A++ P + VK+ LQ + +RY G VDA+ I K +G+ + W G N+ Sbjct: 128 AIAIIVANPTDLVKVRLQSEG-KLPAGVPRRYAGAVDAYFTIVKLEGVSALWTGLGPNIA 186 Query: 438 R 440 R Sbjct: 187 R 187 Score = 31.5 bits (68), Expect = 0.27 Identities = 15/66 (22%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +3 Query: 249 YLAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ--RYKGIVDAFVRIPKEQGLLSFWRGN 422 + A ++ P++ K+ LQ+Q + +Y+G + I +E+G+ W+G Sbjct: 21 FAACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGV 80 Query: 423 FANVIR 440 A + R Sbjct: 81 IAGLHR 86 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 33.5 bits (73), Expect = 0.067 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 A++ P + VK+ LQ + +RY G VDA+ I K +G+ + W G N+ Sbjct: 128 AIAIIVANPTDLVKVRLQSEG-KLPAGVPRRYAGAVDAYFTIVKLEGVSALWTGLGPNIA 186 Query: 438 R 440 R Sbjct: 187 R 187 Score = 31.5 bits (68), Expect = 0.27 Identities = 15/66 (22%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +3 Query: 249 YLAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ--RYKGIVDAFVRIPKEQGLLSFWRGN 422 + A ++ P++ K+ LQ+Q + +Y+G + I +E+G+ W+G Sbjct: 21 FAACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGV 80 Query: 423 FANVIR 440 A + R Sbjct: 81 IAGLHR 86 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 33.5 bits (73), Expect = 0.067 Identities = 21/63 (33%), Positives = 34/63 (53%) Frame = +3 Query: 261 VSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 +S P++ VK LQVQ + +YKG +DA +I +++G F+RG+ V+ Sbjct: 264 LSAYLTTPLDVVKTRLQVQ------GSTIKYKGWLDAVGQIWRKEGPQGFFRGSVPRVMW 317 Query: 441 YFP 449 Y P Sbjct: 318 YLP 320 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 32.7 bits (71), Expect = 0.12 Identities = 19/61 (31%), Positives = 31/61 (50%) Frame = +3 Query: 261 VSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 ++ TA+ P++ +K +Q+ + +YK I AF KEQGL F RG ++ Sbjct: 80 ITHTAITPLDVIKCNMQIDPL--------KYKNITSAFKTTIKEQGLKGFTRGWSPTLLG 131 Query: 441 Y 443 Y Sbjct: 132 Y 132 >At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) identical to 36kDa-peroxisomal membrane protein (PMP36) GI:15146342 from [Arabidopsis thaliana] Length = 331 Score = 32.7 bits (71), Expect = 0.12 Identities = 17/66 (25%), Positives = 36/66 (54%), Gaps = 3/66 (4%) Frame = +3 Query: 252 LAAVSKTAVAPIERVKLLLQVQHVSKQIAAD---QRYKGIVDAFVRIPKEQGLLSFWRGN 422 L AV+K L+++ + +KQ+ Q+YKG +DA +++ + +GL F++G Sbjct: 237 LGAVAKLGATVTTYPLLVVKSRLQAKQVTTGDKRQQYKGTLDAILKMIRYEGLYGFYKGM 296 Query: 423 FANVIR 440 +++ Sbjct: 297 STKIVQ 302 >At4g27940.1 68417.m04009 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 413 Score = 31.5 bits (68), Expect = 0.27 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 348 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 449 +YKG D F +I +++GL WRG A + P Sbjct: 145 QYKGTFDVFTKIIRQEGLGRLWRGTNAGLALAVP 178 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 31.1 bits (67), Expect = 0.36 Identities = 19/59 (32%), Positives = 29/59 (49%) Frame = +3 Query: 273 AVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 449 A+ P E +K+ +Q Q + KG++D F R+ + +GL F RG F R P Sbjct: 128 ALCPFEAIKVRVQTQPMFA--------KGLLDGFPRVYRSEGLAGFHRGLFPLWCRNLP 178 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 31.1 bits (67), Expect = 0.36 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = +3 Query: 249 YLAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 419 + AV+ P++ +K L VQ Q YKG+ D I +E+G + W+G Sbjct: 241 FAGAVTGVLTTPLDVIKTRLMVQGSGTQ------YKGVSDCIKTIIREEGSSALWKG 291 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 30.7 bits (66), Expect = 0.48 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +3 Query: 282 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 419 PI VK LQ+Q Q Q Y G++DAF I KE+G + ++G Sbjct: 126 PIWLVKTRLQLQTPLHQT---QPYSGLLDAFRTIVKEEGPRALYKG 168 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 30.7 bits (66), Expect = 0.48 Identities = 18/64 (28%), Positives = 32/64 (50%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 A++K +AP+E ++ + V S+ I +F+ + ++QG W GN N+I Sbjct: 60 AMTKAVLAPLETIRTRMIVGVGSRSIPG---------SFLEVVQKQGWQGLWAGNEINMI 110 Query: 438 RYFP 449 R P Sbjct: 111 RIIP 114 >At2g47490.1 68415.m05928 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 312 Score = 30.3 bits (65), Expect = 0.63 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +3 Query: 264 SKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 + T P E V+ LQ Q H S ++RY G+ D ++ ++ G F+RG N++R Sbjct: 227 ASTLTYPHEVVRARLQEQGHHS-----EKRYSGVRDCIKKVFEKDGFPGFYRGCATNLLR 281 Query: 441 YFP 449 P Sbjct: 282 TTP 284 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 30.3 bits (65), Expect = 0.63 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +3 Query: 252 LAAVSK-TAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFA 428 LA V+ A P++ VK LQ H + Y+GI D F + K++G WRG Sbjct: 209 LAGVASWVACYPLDVVKTRLQQGHGA--------YEGIADCFRKSVKQEGYTVLWRGLGT 260 Query: 429 NVIRYF 446 V R F Sbjct: 261 AVARAF 266 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 29.9 bits (64), Expect = 0.83 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +3 Query: 303 LLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 ++++Q + D+R YK ++DA ++ + +G+ S WRG+ + R Sbjct: 144 MVRMQADGRLPLTDRRNYKSVLDAITQMIRGEGVTSLWRGSSLTINR 190 >At4g39460.1 68417.m05583 mitochondrial substrate carrier family protein Length = 325 Score = 29.1 bits (62), Expect = 1.5 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +3 Query: 249 YLAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 419 + A++ P++ +K L VQ +KQ Y+GIVD I +E+G + +G Sbjct: 235 FAGALTGAVTTPLDVIKTRLMVQGSAKQ------YQGIVDCVQTIVREEGAPALLKG 285 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 28.7 bits (61), Expect = 1.9 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +3 Query: 276 VAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 419 V P + VK +LQV + RY G +DAF +I K +G+ ++G Sbjct: 231 VYPTDVVKSVLQVDDYK-----NPRYTGSMDAFRKILKSEGVKGLYKG 273 >At4g24570.1 68417.m03521 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 28.7 bits (61), Expect = 1.9 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 333 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 440 +A + Y G+ DA + K +G+ S WRG+ + R Sbjct: 162 LAQRRNYAGVGDAIRSMVKGEGVTSLWRGSALTINR 197 >At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (DTC) identical to dicarboxylate/tricarboxylate carrier [Arabidopsis thaliana] GI:19913113 Length = 298 Score = 28.3 bits (60), Expect = 2.5 Identities = 14/61 (22%), Positives = 29/61 (47%) Frame = +3 Query: 258 AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 437 A+ +P + + +Q + + +A + Y A RI ++G+L+ W+G V+ Sbjct: 117 AIGACVGSPADLALIRMQADN-TLPLAQRRNYTNAFHALTRISADEGVLALWKGCGPTVV 175 Query: 438 R 440 R Sbjct: 176 R 176 >At3g57540.1 68416.m06407 remorin family protein contains Pfam domain, PF03763: Remorin, C-terminal region Length = 296 Score = 27.9 bits (59), Expect = 3.4 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 236 SWLAVSRRRLQDRRSTHRACQAAAPSTARQQADRRRPALQGYR 364 SW+ R+L+DRR+ + A+++A+ RR +G R Sbjct: 224 SWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKR 266 >At5g26200.1 68418.m03118 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 27.5 bits (58), Expect = 4.4 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 6/71 (8%) Frame = +3 Query: 255 AAVSKTAVAPIERVKLLLQVQ---HVSKQIAADQ---RYKGIVDAFVRIPKEQGLLSFWR 416 A ++T PI+ V L VQ +SK + RY+ DAF +I G F+R Sbjct: 144 AVAAQTVWTPIDIVSQGLMVQGDVSLSKHLPGVMNSCRYRNGFDAFRKILYTDGPRGFYR 203 Query: 417 GNFANVIRYFP 449 G +++ Y P Sbjct: 204 GFGISILTYAP 214 >At5g15640.1 68418.m01830 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 323 Score = 27.5 bits (58), Expect = 4.4 Identities = 19/62 (30%), Positives = 27/62 (43%) Frame = +3 Query: 264 SKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRY 443 S+ PI+ V L VQ S Y G +D +I K G+ +RG +V+ Y Sbjct: 139 SQAVFVPIDVVSQKLMVQGYSGHAT----YTGGIDVATKIIKSYGVRGLYRGFGLSVMTY 194 Query: 444 FP 449 P Sbjct: 195 SP 196 >At2g30160.1 68415.m03670 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 27.1 bits (57), Expect = 5.9 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +3 Query: 255 AAVSKTAV-APIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 431 A +S AV P++ VK LQ+ + YKG+ D R+ +E+G +F+ Sbjct: 142 ATISSDAVFTPMDMVKQRLQI--------GNGTYKGVWDCIKRVTREEGFGAFYASYRTT 193 Query: 432 VIRYFP 449 V+ P Sbjct: 194 VLMNAP 199 >At5g58440.1 68418.m07319 phox (PX) domain-containing protein similar to SP|O60749 Sorting nexin 2 {Homo sapiens}; contains Pfam profile PF00787: PX domain Length = 587 Score = 26.6 bits (56), Expect = 7.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 332 DRRRPALQGYRRRLRAHP 385 ++RR AL+ Y RRL AHP Sbjct: 242 EQRRVALEKYLRRLSAHP 259 >At5g27820.1 68418.m03335 ribosomal protein L18 family protein similar to SP|P52863 50S ribosomal protein L18 [Aeromonas proteolytica] {Vibrio proteolyticus} Length = 114 Score = 26.6 bits (56), Expect = 7.7 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = +3 Query: 246 RYLAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 401 R +AA SK ER+ L+ + V+ Q+ +QRY G V A + +E G+ Sbjct: 61 RDVAAASKIGKILGERL-LMKDIPAVTIQMKKEQRYHGKVKAVIDSVREAGV 111 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 26.6 bits (56), Expect = 7.7 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +3 Query: 276 VAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRY 443 V P++ VK +Q+ +YK I F + KEQG+ F+RG ++ Y Sbjct: 96 VTPLDLVKCNMQIDPA--------KYKSISSGFGILLKEQGVKGFFRGWVPTLLGY 143 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 26.6 bits (56), Expect = 7.7 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -2 Query: 252 DTASQEVLSERDRIGEVRHFVRLCDLH*VNMSRWELRHTR 133 D QE++S DR R FVRLC+ + M+R L + + Sbjct: 750 DRQQQEIMSMPDR--PYRKFVRLCERQRLEMNRQVLANQK 787 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 26.6 bits (56), Expect = 7.7 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -2 Query: 252 DTASQEVLSERDRIGEVRHFVRLCDLH*VNMSRWELRHTR 133 D QE++S DR R FVRLC+ + M+R L + + Sbjct: 750 DRQQQEIMSMPDR--PYRKFVRLCERQRLEMNRQVLANQK 787 >At2g17090.1 68415.m01973 protein kinase family protein similar to Arabidopsis thaliana APK1A [SP|Q06548], APK1B [SP|P46573]; contains Pfam profile: PF00069 Protein kinase domain Length = 465 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 138 CAATPTSTYSPSEDHIIEQNVEPRRSG 218 C + +ST P +DH + + EPR G Sbjct: 3 CCYSLSSTVDPVQDHTTDASSEPRNGG 29 >At1g07980.1 68414.m00869 histone-like transcription factor (CBF/NF-Y) family protein contains Pfam profile PF00808: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to Chromatin accessibility complex protein 1 (CHRAC-1) (CHRAC-15) (HuCHRAC15) (DNA polymerase epsilon subunit p15) (SP:Q9NRG0) {Homo sapiens} Length = 206 Score = 26.6 bits (56), Expect = 7.7 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +3 Query: 297 KLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 413 K + +H+S ++ DQRY+ + D+ K + L W Sbjct: 160 KKFIHYKHLSSVVSNDQRYEFLADSVPEKLKAEAALEEW 198 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,751,914 Number of Sequences: 28952 Number of extensions: 196736 Number of successful extensions: 661 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -