BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0556 (752 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 2.6 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 23 2.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.6 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 22 6.0 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 8.0 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 354 SLGSFGLEADVVVLDEVRVFALLY 283 ++GSF DVV+ EVR F + Y Sbjct: 434 AVGSFSRAMDVVLGTEVREFVVNY 457 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 223 LDSLSLFVEKVNYIDRCYTII 285 L SLSLF+ + I CY II Sbjct: 188 LVSLSLFIIPASIIATCYAII 208 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/38 (28%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +3 Query: 33 VNTANRRYTNFRRPGLK---GTSTKRPEPEPETQAPST 137 + T NR + +P K G + +P+P T P+T Sbjct: 2182 LRTINRVLRGYAKPDPKCILGRDNDKTKPKPTTMKPTT 2219 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 102 PEPEPETQAPSTQKPRP 152 P P+P S +KPRP Sbjct: 251 PTPKPRPTKVSRRKPRP 267 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 78 LKGTSTKRPEPEPETQAPSTQKP 146 L G+S + EP P+ TQKP Sbjct: 382 LGGSSNEIVEPVPQPVEEVTQKP 404 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,663 Number of Sequences: 336 Number of extensions: 2953 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -