BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0555 (727 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0651 + 10183050-10184167,10184350-10184974,10185023-101852... 33 0.31 02_05_0941 + 32953065-32953089,32954252-32954406,32954486-329545... 29 3.8 07_03_0264 - 15958690-15958910,15959410-15959484,15959547-159597... 29 5.0 02_02_0015 + 6109552-6109650,6110006-6110078,6111937-6111998,611... 29 5.0 07_03_0602 + 19881998-19882217,19882303-19882496,19883719-198840... 28 6.6 12_01_0910 + 8858443-8859414 28 8.7 >03_02_0651 + 10183050-10184167,10184350-10184974,10185023-10185208, 10185325-10185660 Length = 754 Score = 32.7 bits (71), Expect = 0.31 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = +2 Query: 596 YLLAIVRQRDIKSLRDLDEQHLPLLKRIRDEGKK 697 ++L + R+ + SL D+ ++HLPLL+R+ G K Sbjct: 598 HVLVVSRKDGLDSLADVKKEHLPLLRRMHSAGVK 631 >02_05_0941 + 32953065-32953089,32954252-32954406,32954486-32954587, 32955089-32955140,32955237-32955349,32955542-32955610, 32955942-32956049,32956517-32956661,32957245-32957476, 32957567-32957853,32957951-32958087,32958520-32958667, 32959464-32959595,32960239-32960367,32960707-32960834, 32960911-32961075,32961462-32961587,32962088-32962161, 32962285-32962534,32962875-32963054,32963128-32963361, 32964771-32964840,32965065-32965177,32965403-32965511, 32965639-32965688,32965823-32965889,32966131-32966203, 32966393-32966448,32966729-32966831,32967377-32967458, 32967717-32967779,32967918-32967977,32968356-32968448, 32968561-32968623,32968699-32968797 Length = 1363 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 402 LETPELYKKLTLPHLEKEQFN 464 +ETP +YKKL L L+KE N Sbjct: 102 METPYVYKKLVLKSLDKETLN 122 >07_03_0264 - 15958690-15958910,15959410-15959484,15959547-15959775, 15960312-15960587,15962109-15962369,15962632-15962781, 15963555-15963591,15963958-15964024,15964228-15964291, 15964643-15964812,15965046-15965124,15965576-15965733, 15965862-15966030,15966531-15966602,15966977-15967018, 15967245-15967488,15968782-15968963 Length = 831 Score = 28.7 bits (61), Expect = 5.0 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +2 Query: 467 TVGVQHSRR*K*ARRIVHDNKSEKEGFVLLPDLKWDGLTKETL 595 T G H R K RR+VH +S ++ L PD W + TL Sbjct: 650 TTGELHPERSKMIRRVVHGVQSFRQAISLAPD-AWTAMLFRTL 691 >02_02_0015 + 6109552-6109650,6110006-6110078,6111937-6111998, 6112315-6112376,6112463-6112556,6112673-6113227, 6113379-6113870,6113967-6114137,6115713-6115817, 6115903-6116052,6116372-6116498,6116585-6116648, 6117147-6117203,6117423-6117555,6117660-6117746 Length = 776 Score = 28.7 bits (61), Expect = 5.0 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +2 Query: 260 ENVFRERYLRKLRVFPAFDYKRCENYNNLPSH**AYCQI 376 E+ ER +R L PA KRC N NNL ++ +CQI Sbjct: 7 EDERNERIIRGLLKLPA--NKRCINCNNLTTNVATFCQI 43 >07_03_0602 + 19881998-19882217,19882303-19882496,19883719-19884039, 19885016-19885244,19885554-19885653,19886413-19886539, 19886603-19886780,19886859-19886917,19887082-19887568, 19887682-19887836,19887930-19888100,19888181-19888270, 19888714-19888872,19888940-19889223,19889435-19889498 Length = 945 Score = 28.3 bits (60), Expect = 6.6 Identities = 16/28 (57%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +3 Query: 378 SQQEVHIVLETPELYKKL--TLPHLEKE 455 SQQE H V E P LY+KL +L H E E Sbjct: 674 SQQETHHVPEPPPLYEKLMRSLEHGEPE 701 >12_01_0910 + 8858443-8859414 Length = 323 Score = 27.9 bits (59), Expect = 8.7 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = -3 Query: 257 LVSLEK*PSSLRSFSLKAFFSNRISATPLLSLNFPTTQAVFLLVLL 120 L SL P+SL L A + + PLL L FP T A+ +L LL Sbjct: 133 LASLLSVPASLLRLLLTALPAAPLLLLPLLPLPFPLTAALAVLGLL 178 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,635,686 Number of Sequences: 37544 Number of extensions: 380806 Number of successful extensions: 774 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -