BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0553 (751 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0317 - 22265786-22267618,22267874-22268446,22268546-222686... 40 0.003 05_03_0369 - 13136146-13136175,13136237-13136908,13136926-131370... 29 3.9 01_06_0124 - 26692731-26697046,26698749-26698827,26698899-266989... 29 3.9 08_01_0576 - 5114636-5115151,5115254-5116183,5116898-5117614,511... 29 5.2 05_01_0608 + 5429901-5429982,5430610-5431058,5436758-5437183,543... 28 9.1 02_05_0712 + 31130650-31130786,31130927-31130980,31131076-311312... 28 9.1 >09_06_0317 - 22265786-22267618,22267874-22268446,22268546-22268677, 22268931-22269137,22269287-22269388,22270742-22271032 Length = 1045 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = +1 Query: 268 EISEEYASSLADLTVNSKPLINMLTILAEENIEHAGVIVETV 393 E+ +Y ++L +LT NSKP+I LTI+A EN+ A I + Sbjct: 50 ELVAQYRTALGELTFNSKPIITNLTIIAGENLHAAKPIASLI 91 >05_03_0369 - 13136146-13136175,13136237-13136908,13136926-13137016, 13137184-13137416,13137459-13137731,13137877-13138265, 13138325-13139156,13139847-13139922,13140027-13140414, 13141395-13141748,13142069-13142333,13143366-13143716 Length = 1317 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -3 Query: 575 CSCLTGYKRGLTKLNRCHH-SLSHWCASTP 489 CSCL L L + H +LSH+C TP Sbjct: 836 CSCLEWTPDNLVGLTKLQHLNLSHYCTGTP 865 >01_06_0124 - 26692731-26697046,26698749-26698827,26698899-26698955, 26699321-26699416 Length = 1515 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = +1 Query: 271 ISEEYASSLADLTVNSKPLINMLTILAEEN---IEHAGVIVETVEKHLEKVNF 420 + E AS + D+ N+K L+N + +L+ + EH +I E +EK++F Sbjct: 1160 VQAETASKINDMETNTKDLVNTIVLLSSQKNKVEEHMKIITEAC---MEKMSF 1209 >08_01_0576 - 5114636-5115151,5115254-5116183,5116898-5117614, 5119630-5119746,5119930-5120295,5121365-5121634 Length = 971 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 283 YASSLADLTVNSKPLINMLTILAEEN 360 Y L++LT N KP+I LTI+A ++ Sbjct: 47 YVEVLSELTFNCKPIITELTIIAGQH 72 >05_01_0608 + 5429901-5429982,5430610-5431058,5436758-5437183, 5437270-5437643,5437655-5438113,5438191-5438361, 5438442-5438760 Length = 759 Score = 27.9 bits (59), Expect = 9.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 333 IYQWLAVDGQIRQTGRIFLGDFFRHDDGRPR 241 IY WLA++ + + ++ RH DG P+ Sbjct: 680 IYDWLAIEYALNEASDQYVARGGRHKDGHPK 710 >02_05_0712 + 31130650-31130786,31130927-31130980,31131076-31131249, 31131425-31131530,31131646-31131687,31131768-31131824, 31132410-31132850 Length = 336 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 674 RNYLPYKINLEGNISNRMRGNK 609 RNY P K +L+G + +R RGN+ Sbjct: 40 RNYPPPKWDLQGGVYDRSRGNR 61 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,426,006 Number of Sequences: 37544 Number of extensions: 443372 Number of successful extensions: 999 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 999 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -