BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0549 (643 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g17630.1 68414.m02181 pentatricopeptide (PPR) repeat-containi... 33 0.12 At1g57990.1 68414.m06572 purine permease-related low similarity ... 28 6.1 >At1g17630.1 68414.m02181 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 731 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 422 KRKAQKCSEDFVQQSA**TIYPINNQLIQNIKKKHPTKSSRNF 294 K+K K S + QS TIYP+ L+ ++ KK PT N+ Sbjct: 680 KKKKYKFSSGSIVQSEFETIYPVLEDLVSHMLKKGPTHDGNNY 722 >At1g57990.1 68414.m06572 purine permease-related low similarity to purine permease [Arabidopsis thaliana] GI:7620007; contains Pfam profile PF03151: Domain of unknown function, DUF250 Length = 390 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 474 ARTCLLGSFFFFLHKTFQKKSTEMFR 397 A LGS+F+ LHK +KK E+++ Sbjct: 358 ATVVALGSYFYTLHKRNKKKMVELYQ 383 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,787,769 Number of Sequences: 28952 Number of extensions: 248585 Number of successful extensions: 451 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 451 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -