BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0548 (616 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457566-1|AAL68796.1| 147|Anopheles gambiae multiprotein bridg... 25 1.5 DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted ... 25 1.9 Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor prot... 25 2.6 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 23 5.9 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 23 5.9 >AF457566-1|AAL68796.1| 147|Anopheles gambiae multiprotein bridging factor-like proteinprotein. Length = 147 Score = 25.4 bits (53), Expect = 1.5 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +1 Query: 475 RTSSVVSSGLTESVPVLPTEKMHRRRNEQRCCAIRSCTQTRES 603 +T S ++ + +PV T+K + N+Q A + RE+ Sbjct: 23 KTESAINKARRQGIPVETTQKFNAGTNKQHVAAKNTAKLDRET 65 >DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted carbonic anhydrase protein. Length = 318 Score = 25.0 bits (52), Expect = 1.9 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -2 Query: 384 HWPCRHRRGTEPWYRQILYAIQVHVPCASNSSKS 283 HW ++ RG E I Y +++H+ + KS Sbjct: 131 HWGDKNNRGAEHVLNDIRYPLEMHIIHRNKKYKS 164 >Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor protein. Length = 211 Score = 24.6 bits (51), Expect = 2.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 242 IVATALRCAYVRRPLFDEFD 301 + +A+ CA RPL D+FD Sbjct: 12 VATSAVSCAPTTRPLTDDFD 31 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 23.4 bits (48), Expect = 5.9 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 239 RIVATALRCAYVRRPLFDEFDAQ 307 R+V+ +LRC Y P ++ D + Sbjct: 485 RVVSVSLRCRYCSVPHYEPLDPE 507 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 23.4 bits (48), Expect = 5.9 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 239 RIVATALRCAYVRRPLFDEFDAQ 307 R+V+ +LRC Y P ++ D + Sbjct: 485 RVVSVSLRCRYCSVPHYEPLDPE 507 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 686,517 Number of Sequences: 2352 Number of extensions: 14731 Number of successful extensions: 40 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -