BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0547 (714 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.07c |atg13|apg13, mug78|autophagy associated protein At... 27 3.5 SPCC1393.06c |||rRNA processing protein Ipi1|Schizosaccharomyces... 25 8.1 SPCC576.13 |swc5||chromatin remodeling complex subunit Swc5|Schi... 25 8.1 >SPAC4F10.07c |atg13|apg13, mug78|autophagy associated protein Atg13 |Schizosaccharomyces pombe|chr 1|||Manual Length = 758 Score = 26.6 bits (56), Expect = 3.5 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 Query: 263 VIPSP*MEIPSIYELISPFAILHDNRKSVS 174 VIP E+PS + A LHD RKS S Sbjct: 613 VIPHTQTEVPSANDTSKQLASLHDMRKSQS 642 >SPCC1393.06c |||rRNA processing protein Ipi1|Schizosaccharomyces pombe|chr 3|||Manual Length = 408 Score = 25.4 bits (53), Expect = 8.1 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -2 Query: 218 ISPFAILHDNRKSVSLVTFFLSYRALVIAVSLQWKST 108 I+P +I +D+ K +SL+ R A+SLQWK T Sbjct: 152 ITP-SIRNDSTKFLSLLINACKDRLSSSAISLQWKKT 187 >SPCC576.13 |swc5||chromatin remodeling complex subunit Swc5|Schizosaccharomyces pombe|chr 3|||Manual Length = 215 Score = 25.4 bits (53), Expect = 8.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 270 EASDTITINGDSFDLRANFSVCDSS 196 E DT + GDS D ++FS DSS Sbjct: 13 EEEDTEFVPGDSTDTESSFSDADSS 37 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,627,539 Number of Sequences: 5004 Number of extensions: 49434 Number of successful extensions: 158 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 158 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -