BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0547 (714 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 27 0.77 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 9.5 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 26.6 bits (56), Expect = 0.77 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +3 Query: 480 NEVPYSGFCRPRYMIKNALDEESVVVLTGHIIL*SVC 590 N VP+S FCR I N L + G ++ +C Sbjct: 334 NSVPFSTFCRMGKSIANGLAHLHTEIRKGELVKPCIC 370 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +3 Query: 339 NAIQSDRSRDCSRCTYCRHDVHSLQKPLQQA 431 +A+ +R+ +RC ++ L+KP +A Sbjct: 263 DALNEERTEKHNRCKLAEREMKDLEKPKTEA 293 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,331 Number of Sequences: 2352 Number of extensions: 11481 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -