BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0545 (682 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 25 0.67 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 25 0.88 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 22 4.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.2 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 22 6.2 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 8.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.2 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 25.0 bits (52), Expect = 0.67 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +1 Query: 601 RQIPWL--HERCTMYVIPFSMGPVGSP 675 R++ W H+ +M ++P+ M P G P Sbjct: 59 RRMKWKKEHKMASMNIVPYHMSPYGHP 85 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 24.6 bits (51), Expect = 0.88 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 301 EPLE*EWSAVGKASSTSQSSLVGGAAASNR 212 EPLE G A+ ++ S GAAAS+R Sbjct: 243 EPLELTGGNSGNAAGNNEDSSDSGAAASDR 272 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.2 bits (45), Expect = 4.7 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 580 RGGDVVPQGGLLAGASRGDHVDLP-SEHMNVRDSTRATSAVSV 455 RG D P+G +LA + +H D + +N R++T V + Sbjct: 461 RGLDFTPRGAVLARFTHLNHADFSYTIVINNRNNTSMKGTVRI 503 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 6.2 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 320 LRSTNARTFGVRVVSCGEGFVDLAEQFGGRRGCIQSPLEHIVPS 189 L+++ + VR + CG D F G + C+ EH V S Sbjct: 1584 LKASEDYRYSVRGL-CGNFDHDSTNDFVGPKNCLFRKPEHFVAS 1626 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +1 Query: 265 PSPQLTTLTPKVRAFVERRLLCASRSTCTCATA 363 PSP+ T+TP+ + + + L T + A Sbjct: 132 PSPEWDTVTPEAKNLINQMLTVNPSKRITASEA 164 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -3 Query: 284 VVSCGEGFVD 255 +V+CG GF+D Sbjct: 208 IVACGAGFID 217 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.2 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +3 Query: 498 ICSDGRSTWSPRLAPARSPPWGTTSPPRITRRPCP 602 +C + R T PRLA S P RP P Sbjct: 1332 LCRNSRRTPVPRLAQDSSEDESYRGPSASGGRPVP 1366 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,749 Number of Sequences: 438 Number of extensions: 3810 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -