BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0543 (723 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce... 30 0.38 SPAC1687.17c |||Der1-like |Schizosaccharomyces pombe|chr 1|||Manual 29 0.67 SPBC1D7.04 |mlo3||RNA annealing factor Mlo3|Schizosaccharomyces ... 27 2.7 SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo... 27 3.6 SPAC17G8.03c |dpb3||DNA polymerase epsilon subunit Dpb3|Schizosa... 26 4.7 SPBC13G1.10c |mug81||ATP-dependent RNA helicase Slh1|Schizosacch... 26 6.3 SPAC1565.01 |||conserved fungal protein|Schizosaccharomyces pomb... 25 8.3 >SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1610 Score = 29.9 bits (64), Expect = 0.38 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -3 Query: 694 QYHHSIKIGL*NWSMIFIHLKFTTFFINIKYNKIVKL 584 +Y H++++ L W +IF H + TT+ NIK + I +L Sbjct: 1316 KYEHALRVYLLVWDLIFYHFEETTY--NIKLSIINQL 1350 >SPAC1687.17c |||Der1-like |Schizosaccharomyces pombe|chr 1|||Manual Length = 168 Score = 29.1 bits (62), Expect = 0.67 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 139 IFFSVWYLGTFSFMCLRRLYFRLRSWLYIWSW 44 ++FS+ FS+M YF + LYIWSW Sbjct: 80 VWFSLLVTSYFSYMPFAASYFSF-TMLYIWSW 110 >SPBC1D7.04 |mlo3||RNA annealing factor Mlo3|Schizosaccharomyces pombe|chr 2|||Manual Length = 199 Score = 27.1 bits (57), Expect = 2.7 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +2 Query: 218 PSDTAKPNKETLKSLKKMVLQRFRILICRDLEVVLNLNVKDLF 346 P+ AKP T +LK ++ + +I++ V VK+LF Sbjct: 33 PTKNAKPAVNTASALKSVISEESKIIVSNLPTDVTEAQVKELF 75 >SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1826 Score = 26.6 bits (56), Expect = 3.6 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = -3 Query: 181 FYTCPYFWSIFLNQIFFSVWYLGTFSFMCLRRLYFRLRSWLYIWSWFYFGAWKIPLLVW 5 F T Y SIF N + Y+ T + R+ F + LY S Y G+ I +L++ Sbjct: 1374 FVTQNYANSIFTNLTYGGARYIATGRGLATTRVPFSVLYSLYTGSSIYLGSRLIMMLLF 1432 >SPAC17G8.03c |dpb3||DNA polymerase epsilon subunit Dpb3|Schizosaccharomyces pombe|chr 1|||Manual Length = 199 Score = 26.2 bits (55), Expect = 4.7 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = +2 Query: 86 SSQTHKTESAQVPDRKENLVQKDTPKIRAGVKSATQEIPIKEEIPSDTAKPNKETLKSL 262 +++ ES K+N V+++ +I +SAT E P+KEE + + + E S+ Sbjct: 123 ANEGEHNESVPAKKVKKNTVKEE--EIEKDDESATTETPVKEEPTGEETEADHEEKASV 179 >SPBC13G1.10c |mug81||ATP-dependent RNA helicase Slh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1935 Score = 25.8 bits (54), Expect = 6.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 362 KYKITQRDPSHSNLKQPRGLYRLGFGI 282 KY + QRD S S K+ + L++ GI Sbjct: 564 KYSLAQRDVSKSKNKELKELFKYSMGI 590 >SPAC1565.01 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 242 Score = 25.4 bits (53), Expect = 8.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 124 WYLGTFSFMCLRRLYFRLRSWLYIWS 47 W +G RRL F L+SWL I S Sbjct: 35 WLIGNRYSAGFRRLPFSLKSWLVIGS 60 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,923,014 Number of Sequences: 5004 Number of extensions: 61261 Number of successful extensions: 205 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 205 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -