BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0542 (737 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0601 - 5268520-5271112,5272448-5272950 33 0.31 12_01_0399 + 3152219-3152721,3152995-3153127,3155013-3155097,315... 29 2.9 03_02_0834 - 11630288-11630500,11630531-11630623,11630844-116310... 29 2.9 04_04_0369 - 24745140-24745510,24746005-24746089,24746746-247468... 29 3.9 03_06_0748 - 35971065-35971268,35972022-35972597 28 6.7 >08_01_0601 - 5268520-5271112,5272448-5272950 Length = 1031 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = -1 Query: 581 TELGEKCSDLQREIRYLKALMRDLSRRRV*SSKS 480 TE+G+K +L+ E+ +L+ +RD R+R SS S Sbjct: 25 TEVGKKVLELRHELEWLRTFLRDADRKRRGSSSS 58 >12_01_0399 + 3152219-3152721,3152995-3153127,3155013-3155097, 3155321-3155586 Length = 328 Score = 29.5 bits (63), Expect = 2.9 Identities = 18/68 (26%), Positives = 32/68 (47%) Frame = -1 Query: 704 VDDRRSRKKEQNKNAATRYRQXXXXXXXXXXXXEQTLRQRHTELGEKCSDLQREIRYLKA 525 +D +R+++ N+ +A R ++ QTL+ T L + + LQR+ L A Sbjct: 161 IDPKRAKRILANRQSAARSKERKIKYTSELERKVQTLQTEATTLSAQLTLLQRDTSGLTA 220 Query: 524 LMRDLSRR 501 R+L R Sbjct: 221 ENRELKLR 228 >03_02_0834 - 11630288-11630500,11630531-11630623,11630844-11631050, 11631301-11633089,11633817-11634145 Length = 876 Score = 29.5 bits (63), Expect = 2.9 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = -1 Query: 602 QTLRQRHTELGEKCSDLQREIRYLKALMRDLSRRRV*SSKSINNAASREIKQYAKTHKAI 423 Q LR+R EL E+ QRE+ L++ D+S ++ S + N + E+++ K H + Sbjct: 414 QRLRERVRELAEQNVSFQREVTLLESNRIDVS-NKITSLELQNKQLNDELQKVKKEHDTL 472 >04_04_0369 - 24745140-24745510,24746005-24746089,24746746-24746878, 24747764-24748584 Length = 469 Score = 29.1 bits (62), Expect = 3.9 Identities = 19/68 (27%), Positives = 31/68 (45%) Frame = -1 Query: 704 VDDRRSRKKEQNKNAATRYRQXXXXXXXXXXXXEQTLRQRHTELGEKCSDLQREIRYLKA 525 VD +R+++ N+ +A R ++ QTL+ T L + S LQR+ L + Sbjct: 267 VDPKRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLSMLQRDTTGLTS 326 Query: 524 LMRDLSRR 501 DL R Sbjct: 327 ENSDLKIR 334 >03_06_0748 - 35971065-35971268,35972022-35972597 Length = 259 Score = 28.3 bits (60), Expect = 6.7 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = -3 Query: 336 LHLSEQIRCHIIEQHKLRHHQRDTNNTCKVAPFFIIHSFINSLI 205 L LS Q+R E H+ H+ D+N TC V P SF N+L+ Sbjct: 62 LRLSPQLRWE--EAHEPLHNGIDSNRTCGVGPGM---SFANALL 100 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,935,552 Number of Sequences: 37544 Number of extensions: 272022 Number of successful extensions: 547 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -