BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0537 (739 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 2.4 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 23 9.8 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 25.0 bits (52), Expect = 2.4 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -1 Query: 475 LYMHWN-VSGESNENTCCSYGMKAMLISFNVLIYLAIWLRDNSLNRI 338 L++ +N ++ +N +G+K + + N L+ +WL LN I Sbjct: 869 LFLQYNRIASIANHTFDHLHGLKILRLDHNRLVEFNVWLLPKQLNDI 915 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 420 YEQQVFSLDSPETFQCMY 473 Y +++LD PET MY Sbjct: 247 YLTHIYTLDQPETVDMMY 264 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 768,450 Number of Sequences: 2352 Number of extensions: 16311 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -