BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0534 (759 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 2.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 2.5 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 24 4.4 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.0 bits (52), Expect = 2.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 272 VSSKWFFPRWAQALI 316 V K+FFP+W Q L+ Sbjct: 672 VLDKYFFPKWLQTLV 686 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.0 bits (52), Expect = 2.5 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +2 Query: 599 GSSTLKLRSLQVQPVKVQVNYYHKQRSQLMTSQHQQEAQWMISH 730 G T + +Q+QP++ + Q Q + Q QQ+ Q H Sbjct: 1279 GMPTHQHSQIQLQPIQQPLQTLQHQYQQQLQQQQQQQQQQQQQH 1322 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 189 PNPMNPAVIGTDVVERKVVD 248 PNP N A+ G D RKV D Sbjct: 345 PNPSNTALKGADAPLRKVGD 364 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 784,590 Number of Sequences: 2352 Number of extensions: 16754 Number of successful extensions: 29 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -