BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0532 (614 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0340 + 16815560-16815838 28 6.8 01_01_0178 + 1514878-1515417 28 6.8 >09_04_0340 + 16815560-16815838 Length = 92 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -3 Query: 351 VDLRSAKAR*PNNVALDAIDGGAPPGIAVELRQAT 247 VD R +A N ALDA+ APP E+ AT Sbjct: 46 VDKRVTEASQDINEALDAVVAAAPPAKKAEIEDAT 80 >01_01_0178 + 1514878-1515417 Length = 179 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -3 Query: 564 RARRWWCCSGCLVTRA--SCCSDGNSLRSRSGG 472 R+R W CC + TR+ CS + ++S SGG Sbjct: 114 RSRPWKCCDDAVCTRSMPPTCSCQDKVKSCSGG 146 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,533,598 Number of Sequences: 37544 Number of extensions: 279660 Number of successful extensions: 871 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -