BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0531 (765 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC037386-1|AAH37386.1| 494|Homo sapiens PARP8 protein protein. 31 4.5 >BC037386-1|AAH37386.1| 494|Homo sapiens PARP8 protein protein. Length = 494 Score = 31.1 bits (67), Expect = 4.5 Identities = 11/36 (30%), Positives = 26/36 (72%) Frame = +3 Query: 111 SYGYTGIDKDESIVSQDKVAFTNDNGNLYQSKESRS 218 S+GY+G++K + + ++D+ A ++ + N QS++ R+ Sbjct: 451 SFGYSGMNKKQKVSAKDEPASSSKSSNTSQSQKKRT 486 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,279,023 Number of Sequences: 237096 Number of extensions: 1914775 Number of successful extensions: 7730 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 7631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7728 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9199990470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -