BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0530 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 2.4 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 23 3.1 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 4.1 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 22 5.4 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 21 9.5 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +3 Query: 567 FQNILTEIYRIVSQRQMRDPPEGDVIRPDAEP 662 ++ I IY ++S + PP D+I + P Sbjct: 23 YKTIKQHIYSLISLSYLPGPPVNDIISGNIPP 54 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 22.6 bits (46), Expect = 3.1 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 112 SKLYSLEILVWVKAVF 159 + LYSL +L+W+ F Sbjct: 248 NSLYSLHLLLWITVTF 263 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +3 Query: 567 FQNILTEIYRIVSQRQMRDPPEGDVIRPDAEP 662 ++ I IY ++S + PP D+I + P Sbjct: 23 YKTIKQHIYSLISLSYLPGPPVNDIISGNILP 54 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.8 bits (44), Expect = 5.4 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = +2 Query: 200 IYHRCGICNKKY 235 + H+C +C+KK+ Sbjct: 193 VLHQCPVCHKKF 204 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 154 LLLPTPESPMSTTLNK*SYSSSLVP 80 LL+P P+ ST + +YS S P Sbjct: 198 LLVPIPQRTASTASSASNYSPSQSP 222 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,494 Number of Sequences: 336 Number of extensions: 2574 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -