BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0530 (690 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 24 1.6 AB264332-1|BAF44087.1| 58|Apis mellifera ecdysone-induced prot... 23 2.1 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.1 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 8.4 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 99 YDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVE 218 ++Y+ KV+ I S +LL RF NLE I V+ Sbjct: 165 FNYM-KVIFIHSSDTDGRALLGRFQTTSQNLEDDVEIKVQ 203 >AB264332-1|BAF44087.1| 58|Apis mellifera ecdysone-induced protein 75 protein. Length = 58 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 627 PEGDVIRPDAEPAD 668 P GD++ P +EP D Sbjct: 18 PSGDILSPSSEPLD 31 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 627 PEGDVIRPDAEPAD 668 P GD++ P +EP D Sbjct: 18 PSGDILSPSSEPLD 31 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +1 Query: 250 RPKSSDMGHGRAGAVPRHHV 309 RP++ D GH + R+ V Sbjct: 427 RPRAKDYGHSSGSVIDRNGV 446 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,788 Number of Sequences: 438 Number of extensions: 3199 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -