BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0529 (679 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G9.05 |mpf1||meiotic PUF family protein 1|Schizosaccharomyc... 28 1.4 SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharo... 26 4.4 >SPAC4G9.05 |mpf1||meiotic PUF family protein 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 27.9 bits (59), Expect = 1.4 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 166 PVQTDAILNTSGNFLAIFCFKTSNEFQLYSLVY 264 P + N GNFL CF+ S E QL S Y Sbjct: 294 PFSVTLMKNKFGNFLIQKCFEYSTEAQLQSFSY 326 >SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharomyces pombe|chr 3|||Manual Length = 1369 Score = 26.2 bits (55), Expect = 4.4 Identities = 18/55 (32%), Positives = 29/55 (52%) Frame = +1 Query: 142 LYLKQYRWPVQTDAILNTSGNFLAIFCFKTSNEFQLYSLVYSNFKTNNFETIFVL 306 LYLK + WP+ T I + G L+I F+ S + S F+ NN +++V+ Sbjct: 936 LYLKVFTWPLYT--IFLSLGQILSISSFQLS--------LLSGFEDNNQISLYVI 980 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,392,359 Number of Sequences: 5004 Number of extensions: 43991 Number of successful extensions: 96 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -