BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0529 (679 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0707 - 24468329-24468448,24468794-24468940,24469050-244691... 29 4.5 >01_05_0707 - 24468329-24468448,24468794-24468940,24469050-24469103, 24469185-24469300,24470537-24470583,24470686-24470723, 24471050-24471268,24471504-24471602,24471675-24471728, 24472907-24473148,24474258-24474447 Length = 441 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +1 Query: 100 GEHCKYN---QLIVNSRLYLKQYRWPVQTDAILNTSGNFLAIFCFKTSN 237 G C++N +L++N L L Q P +LN+S NF+ F F ++ Sbjct: 285 GSTCRFNHPDRLVLNFPLPLGQTILPTPESMLLNSSANFMQGFDFHAAH 333 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,163,699 Number of Sequences: 37544 Number of extensions: 212097 Number of successful extensions: 370 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 370 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -