BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0529 (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45181| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_53949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_35182| Best HMM Match : CUB (HMM E-Value=0) 28 6.0 SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) 28 8.0 >SB_45181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 747 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -2 Query: 141 SGIYYKLIIFTVLALVIDKKLQDNSILRLKILKNIYNFTF 22 S ++Y ++ T+ V+D DN IL + K YN TF Sbjct: 277 SRLFYNEVLETIRLGVVDGVSGDNMILEINASKYAYNVTF 316 >SB_53949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 211 LRNFQTYLKWRLFVLANDIVLGT 143 L+NFQ +L+W F + N + +GT Sbjct: 167 LKNFQVFLQWPNFYMNNVVFIGT 189 >SB_35182| Best HMM Match : CUB (HMM E-Value=0) Length = 963 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 468 PF*HAIKNLFEIFNFERSKASLKIDYNSKSPWQ 566 P HA+ FE+FN ERS K Y+S W+ Sbjct: 248 PITHALTLTFEVFNIERSS---KCKYDSVEIWE 277 >SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) Length = 574 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +3 Query: 585 KTCNIILSLATEFWNRDVKIQSL 653 +TC I+LS+A EF+N D+ ++L Sbjct: 141 ETCLIVLSIADEFYNLDLNKKAL 163 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,324,721 Number of Sequences: 59808 Number of extensions: 278495 Number of successful extensions: 588 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 588 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -