BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0525 (752 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0273 + 2115257-2115589,2115706-2115766,2115876-2115970,211... 107 7e-24 01_02_0039 - 10490522-10490606,10490674-10490810,10491107-104912... 106 2e-23 01_05_0795 + 25287449-25287967,25288078-25288138,25288640-252887... 105 4e-23 05_07_0145 + 28012268-28012624,28012734-28012794,28013758-280138... 105 5e-23 01_06_0158 - 27079262-27079346,27079662-27079750,27080540-270806... 104 9e-23 05_06_0040 + 25116732-25118030 41 0.001 01_01_0555 + 4080316-4081680 41 0.001 02_05_0763 + 31583449-31583747,31584095-31584230,31584544-315845... 40 0.003 06_03_0732 + 23965090-23965431,23965610-23965746,23967359-239674... 39 0.004 07_03_0712 - 20878272-20879633 38 0.006 04_02_0012 + 8537124-8537464,8537558-8537693,8538811-8538861,854... 38 0.006 09_06_0132 - 21042653-21042873,21042950-21043027,21043106-210431... 38 0.009 09_06_0239 - 21794691-21795986 38 0.011 07_03_0705 - 20846810-20848165 38 0.011 05_07_0313 - 29159638-29161065 37 0.015 09_04_0549 + 18478475-18478664,18479381-18480648 37 0.020 09_04_0547 + 18467016-18467205,18467922-18469189 37 0.020 07_03_0708 - 20865786-20867153 37 0.020 01_06_0523 - 30009191-30010531 37 0.020 03_02_0806 + 11391880-11391916,11392247-11393634 36 0.026 01_06_0905 + 32880368-32880633,32882439-32882568,32882704-328828... 36 0.026 12_01_0345 - 2649701-2650819 36 0.035 06_03_1412 + 29993566-29993873,29993960-29994583,29994665-299948... 36 0.035 03_02_0811 + 11437654-11438958 36 0.046 03_02_0809 + 11419318-11420493 36 0.046 03_02_0807 + 11398845-11399999 36 0.046 02_05_0626 - 30456714-30456829,30456951-30457023,30457136-304572... 36 0.046 02_05_0552 - 29911280-29912541,29912633-29912762 36 0.046 01_06_0258 + 27950196-27950749,27953670-27954570 36 0.046 01_05_0656 + 24011784-24011844,24012737-24012862,24014761-24016052 36 0.046 09_04_0355 + 16922863-16924224 35 0.060 09_04_0353 + 16915618-16916934 35 0.060 04_04_1647 + 35032328-35033803 35 0.060 04_04_0042 + 22328464-22329858 35 0.060 04_03_0432 - 15861997-15862096,15862449-15862519,15862612-158627... 35 0.060 05_04_0147 - 18419864-18421297 35 0.080 11_01_0539 + 4268326-4268450,4268586-4268751 34 0.14 04_04_0040 + 22322839-22324173 34 0.14 07_03_0704 + 20831071-20832381 33 0.18 05_04_0099 - 17991569-17993014 33 0.18 04_03_0428 - 15820169-15820236,15820296-15820367,15820450-158205... 33 0.18 04_03_0418 - 15686775-15686842,15686902-15686973,15687056-156871... 33 0.18 02_03_0194 - 16215032-16215177,16215322-16215393,16215518-162155... 33 0.18 02_02_0636 + 12463660-12465204 33 0.18 12_02_0913 + 24246217-24247557 33 0.24 06_01_1092 + 8966584-8967053,8967737-8967854,8968030-8968253,896... 33 0.24 02_05_0551 + 29907768-29907909,29907995-29909280 33 0.24 12_01_0494 + 3931664-3931830,3932034-3932151,3932661-3932896,393... 33 0.32 06_01_0746 + 5580755-5582119 33 0.32 01_01_0261 + 2119519-2121033 33 0.32 08_01_0711 - 6275052-6276401 32 0.43 07_03_0710 - 20873420-20874745 32 0.43 05_07_0071 - 27481876-27482737,27484328-27484950 32 0.43 04_04_1586 - 34621945-34623366 32 0.43 11_02_0009 - 7315669-7315686,7316239-7316259,7316425-7316519,731... 32 0.56 10_08_0770 + 20459888-20461036 32 0.56 08_02_0960 + 23058393-23059739 32 0.56 04_01_0509 + 6668208-6668653,6669776-6669779 32 0.56 03_02_0519 + 9066918-9068261 32 0.56 07_03_1115 - 24076506-24076677,24077169-24077266,24077622-240777... 31 0.74 04_03_0316 + 14261942-14262506,14262710-14263134 31 0.74 04_03_0281 - 13872289-13872891 31 0.74 01_06_1318 - 36261483-36262811 31 0.74 04_01_0470 - 6062054-6062134,6062262-6062528,6062578-6062583 31 0.98 01_05_0596 + 23511148-23512650 31 0.98 10_08_0769 + 20452130-20453314 31 1.3 10_08_0766 + 20437772-20438956 31 1.3 02_05_0554 + 29929860-29929959,29932944-29934220 30 1.7 12_02_0674 - 21745321-21746223,21746229-21747608 30 2.3 10_08_0775 + 20484776-20486035 30 2.3 06_01_0772 + 5770502-5770619,5771035-5772335 30 2.3 04_03_0444 - 16006619-16006733,16006754-16007048,16008265-16008967 30 2.3 10_06_0011 - 9581916-9582167,9582523-9582574,9584105-9584331 29 3.0 08_02_1095 - 24278295-24278741,24279066-24279307,24279647-242797... 29 4.0 10_08_0774 + 20478203-20479393 29 5.2 06_03_1283 - 28957729-28959258,28959354-28959550,28959824-289600... 29 5.2 04_04_1013 + 30109321-30110790 29 5.2 04_04_1006 + 30048618-30050087 29 5.2 03_02_0810 + 11429776-11429985,11430003-11430935 29 5.2 01_07_0213 - 42028941-42029055,42029444-42029480,42029876-420302... 29 5.2 01_06_1474 + 37630471-37631736,37631965-37632028,37632928-37633124 29 5.2 10_08_0778 + 20492822-20493920,20494605-20494648 28 6.9 06_03_0635 - 22971502-22973840,22974112-22974403,22974639-229751... 28 6.9 03_04_0243 + 19298293-19299117 28 6.9 02_05_0180 - 26519845-26520684 28 6.9 11_01_0720 - 5943243-5944399,5946142-5946271 28 9.2 10_08_0773 + 20474642-20475835 28 9.2 10_08_0083 - 14715517-14715595,14716022-14716150,14716280-147164... 28 9.2 06_03_0395 - 20354713-20355570 28 9.2 06_01_1084 + 8883301-8883515,8883736-8884063,8884764-8885022,888... 28 9.2 01_06_1068 - 34270420-34270581,34272185-34272238,34273741-34274070 28 9.2 01_01_1006 - 7972645-7973811 28 9.2 >05_01_0273 + 2115257-2115589,2115706-2115766,2115876-2115970, 2116072-2116184,2116278-2116551,2116923-2117036, 2117169-2117233,2117325-2117466,2117547-2117666, 2118153-2118241,2118349-2118433 Length = 496 Score = 107 bits (258), Expect = 7e-24 Identities = 47/76 (61%), Positives = 60/76 (78%) Frame = +2 Query: 263 PEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRK 442 P PL +YL+ QYYGVI +G+PPQ+F V+FDTGSSNLWVPS KC Y +IAC LH++Y+S+K Sbjct: 66 PVPLVDYLNTQYYGVIGLGSPPQNFTVIFDTGSSNLWVPSAKC-YFSIACYLHSRYNSKK 124 Query: 443 SKTYVANGTQFAIQYG 490 S +Y A+G I YG Sbjct: 125 SSSYKADGETCKITYG 140 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%) Frame = +1 Query: 514 STDDVTVGGLKVRRQTFAEAVSEPGLAFVAAKFDGILGMAFSTIAVDHVTPVFDNMVAQG 693 S D+V VG L V+ Q F EA E + F+ KFDGILG+ + I+V P++ +M Q Sbjct: 149 SKDNVLVGDLVVKNQKFIEATRETSVTFIIGKFDGILGLGYPEISVGKAPPIWQSMQEQE 208 Query: 694 LV-QPVFSFYLNRDPGGDNG 750 L+ VFSF+LNRDP +G Sbjct: 209 LLADDVFSFWLNRDPDASSG 228 >01_02_0039 - 10490522-10490606,10490674-10490810,10491107-10491248, 10491355-10491419,10491528-10491641,10491846-10492119, 10492215-10492327,10492405-10492499,10492602-10492662, 10492774-10493103 Length = 471 Score = 106 bits (255), Expect = 2e-23 Identities = 47/74 (63%), Positives = 56/74 (75%) Frame = +2 Query: 269 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 448 PL NYLD QY+G I IGTPPQ+F V+FDTGSSNLWVPS KC Y +IAC LH++Y S+ S Sbjct: 67 PLDNYLDTQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSVKC-YFSIACYLHHRYKSKGSS 125 Query: 449 TYVANGTQFAIQYG 490 +Y NG +I YG Sbjct: 126 SYKKNGESCSISYG 139 Score = 77.4 bits (182), Expect = 1e-14 Identities = 38/80 (47%), Positives = 47/80 (58%), Gaps = 1/80 (1%) Frame = +1 Query: 514 STDDVTVGGLKVRRQTFAEAVSEPGLAFVAAKFDGILGMAFSTIAVDHVTPVFDNMVAQG 693 S D V VG L V+ Q F E EP L F+ KFDGILG+ F I+V P++ M Q Sbjct: 148 SEDSVLVGDLAVKNQMFIETTREPSLTFIIGKFDGILGLGFPEISVGGAPPIWQGMKEQQ 207 Query: 694 LVQ-PVFSFYLNRDPGGDNG 750 L++ VFSF+LNRDP G Sbjct: 208 LIEKDVFSFWLNRDPDAPTG 227 >01_05_0795 + 25287449-25287967,25288078-25288138,25288640-25288734, 25288827-25288939,25289480-25289648,25289777-25289816, 25289906-25289970,25290150-25290263,25290398-25290462, 25290572-25290725,25290798-25290914,25292489-25292545 Length = 522 Score = 105 bits (252), Expect = 4e-23 Identities = 46/76 (60%), Positives = 57/76 (75%) Frame = +2 Query: 263 PEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRK 442 P L N+L+AQY+G I +G PPQ+F VVFDTGSSNLWVPS KC + ++AC H KY+SR Sbjct: 128 PLALKNFLNAQYFGEIGVGCPPQNFTVVFDTGSSNLWVPSAKCVF-SLACYFHRKYESRS 186 Query: 443 SKTYVANGTQFAIQYG 490 S TY+ NGT +I YG Sbjct: 187 SSTYMENGTPASIHYG 202 Score = 87.0 bits (206), Expect = 1e-17 Identities = 44/80 (55%), Positives = 53/80 (66%), Gaps = 1/80 (1%) Frame = +1 Query: 514 STDDVTVGGLKVRRQTFAEAVSEPGLAFVAAKFDGILGMAFSTIAVDHVTPVFDNMVAQG 693 S D VT+G L V Q F EA EPGL F+AAKFDGILG+ F I+V+ PV+ NM+ Q Sbjct: 211 SQDQVTIGDLVVNNQEFIEATHEPGLTFLAAKFDGILGLGFKEISVEGADPVWYNMIQQS 270 Query: 694 LV-QPVFSFYLNRDPGGDNG 750 LV VFSF+LNR+ NG Sbjct: 271 LVTDKVFSFWLNRNANDING 290 >05_07_0145 + 28012268-28012624,28012734-28012794,28013758-28013852, 28013944-28014056,28014436-28014604,28014677-28014716, 28014797-28014861,28015485-28015598,28015687-28015751, 28015927-28016083,28016167-28016286,28016447-28016535, 28016631-28016715 Length = 509 Score = 105 bits (251), Expect = 5e-23 Identities = 46/73 (63%), Positives = 55/73 (75%) Frame = +2 Query: 272 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKT 451 L NY++AQY+G I +GTPPQ F V+FDTGSSNLWVPS KC Y +IAC H++Y S +S T Sbjct: 77 LKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKC-YFSIACFFHSRYKSGQSST 135 Query: 452 YVANGTQFAIQYG 490 Y NG AIQYG Sbjct: 136 YQKNGKPAAIQYG 148 Score = 85.4 bits (202), Expect = 4e-17 Identities = 43/73 (58%), Positives = 50/73 (68%), Gaps = 1/73 (1%) Frame = +1 Query: 514 STDDVTVGGLKVRRQTFAEAVSEPGLAFVAAKFDGILGMAFSTIAVDHVTPVFDNMVAQG 693 S D VTVG L V+ Q F EA EPGL F+ AKFDGILG+ F I+V PV+ MV QG Sbjct: 157 SEDSVTVGDLVVKDQEFIEATKEPGLTFMVAKFDGILGLGFQEISVGDAVPVWYKMVEQG 216 Query: 694 LV-QPVFSFYLNR 729 LV +PVFSF+ NR Sbjct: 217 LVSEPVFSFWFNR 229 >01_06_0158 - 27079262-27079346,27079662-27079750,27080540-27080659, 27080738-27080894,27081167-27081231,27081323-27081436, 27082109-27082178,27082412-27082642,27082963-27083039, 27083143-27083237,27084514-27084574,27084678-27085073 Length = 519 Score = 104 bits (249), Expect = 9e-23 Identities = 46/73 (63%), Positives = 55/73 (75%) Frame = +2 Query: 272 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKT 451 L NYL+AQYYG I+IGTPPQ F V+FDTGSSNLWVPS KCH +IAC H++Y + +S T Sbjct: 90 LKNYLNAQYYGEIAIGTPPQMFTVIFDTGSSNLWVPSSKCH-LSIACYFHSRYKAGQSST 148 Query: 452 YVANGTQFAIQYG 490 Y NG +I YG Sbjct: 149 YKKNGKPASIHYG 161 Score = 30.3 bits (65), Expect = 1.7 Identities = 29/75 (38%), Positives = 34/75 (45%), Gaps = 3/75 (4%) Frame = +1 Query: 514 STDDVTVGGLKVRRQTFAEAVSEPGLAFVAAKFDGILGMAFSTIAVDHVTPVFD--NMVA 687 S D V VG + V+ Q V L A F G L + S V + NMV Sbjct: 170 SQDSVKVGDVAVKNQLRGSQVLHSWLQSSMA-FLG-LDLRKSRFPVTDIAKQTHRYNMVR 227 Query: 688 QGLV-QPVFSFYLNR 729 QGLV PVFSF+ NR Sbjct: 228 QGLVVDPVFSFWFNR 242 >05_06_0040 + 25116732-25118030 Length = 432 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +2 Query: 266 EPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVP 379 EP++ Y D Y +++G PPQ F+V DTGS WVP Sbjct: 16 EPVTTYTDG-YLLSLNLGMPPQVFQVYLDTGSDLTWVP 52 >01_01_0555 + 4080316-4081680 Length = 454 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHY-TNIACLLHNKYDSRKSKTY 454 +Y +++G+PP+S + DTGS +WV KK + T+ A ++D +S TY Sbjct: 100 EYLMTVNLGSPPRSMLAIADTGSDLVWVKCKKGNNDTSSAAAPTTQFDPSRSSTY 154 >02_05_0763 + 31583449-31583747,31584095-31584230,31584544-31584593, 31585586-31585852,31586481-31586708,31586873-31587011, 31587091-31587161,31587313-31587412,31588201-31588264, 31588346-31588417,31588500-31588720 Length = 548 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/37 (48%), Positives = 20/37 (54%) Frame = +2 Query: 269 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVP 379 P N L YY + +GTP SF V DTGS WVP Sbjct: 93 PSGNDLGWLYYTWVDVGTPNTSFLVALDTGSDLFWVP 129 >06_03_0732 + 23965090-23965431,23965610-23965746,23967359-23967417, 23968817-23970135 Length = 618 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTY 454 Y + +GTP + VVFDTGS WV + C +AC + +D S TY Sbjct: 282 YVVTVGLGTPASRYTVVFDTGSDTTWVQCQPC---VVACYEQREKLFDPASSSTY 333 >07_03_0712 - 20878272-20879633 Length = 453 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +2 Query: 257 PSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 P+ + L N +Y ++IGTPPQS+ + DTGS +W C Sbjct: 81 PTRKDLPN--GGEYIMTLAIGTPPQSYPAIADTGSDLVWTQCAPC 123 >04_02_0012 + 8537124-8537464,8537558-8537693,8538811-8538861, 8540190-8540413,8540491-8540715,8541520-8541619, 8541703-8541763,8543029-8543100,8543183-8543406 Length = 477 Score = 38.3 bits (85), Expect = 0.006 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVP 379 +Y ++++GTP Q+F V DTGS W+P Sbjct: 116 HYALVTVGTPGQTFMVALDTGSDLFWLP 143 >09_06_0132 - 21042653-21042873,21042950-21043027,21043106-21043167, 21043504-21043578,21043664-21043752,21043825-21043905, 21044939-21045076,21046299-21046429,21046521-21046592, 21047218-21047275,21047362-21047461,21047544-21047617, 21047701-21047836,21047913-21048137,21048211-21048446, 21048949-21049081,21049195-21049484 Length = 732 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 454 +Y V+++GTP +F V DTGS WVP C A Y S K Y Sbjct: 99 HYAVVALGTPNVTFLVALDTGSDLFWVP---CDCLKCAPFQSPNYGSLKFDVY 148 >09_06_0239 - 21794691-21795986 Length = 431 Score = 37.5 bits (83), Expect = 0.011 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +2 Query: 308 ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLH--NKYDSRKSKTYVANGTQFAI 481 + IGTP + +VFDT S LW + C ++C+ + YD K++TY AN T + Sbjct: 92 LGIGTPAMNVTLVFDTTSDLLWTQCQPC----LSCVAQAGDMYDPNKTETY-ANLTSSSY 146 Query: 482 QY 487 Y Sbjct: 147 NY 148 >07_03_0705 - 20846810-20848165 Length = 451 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +2 Query: 308 ISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 +SIGTPP +F V+ DTGSS +W C Sbjct: 94 LSIGTPPVTFSVLADTGSSLIWTQCAPC 121 >05_07_0313 - 29159638-29161065 Length = 475 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYVA 460 +Y+ + +GTP + +V DTGS +W+ C + +D R+S++Y A Sbjct: 121 EYFAQVGVGTPATTALMVLDTGSDVVWLQCAPCRHCYAQS--GRVFDPRRSRSYAA 174 >09_04_0549 + 18478475-18478664,18479381-18480648 Length = 485 Score = 36.7 bits (81), Expect = 0.020 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 Y + +GTP + + V+FDTGS WV K C Sbjct: 149 YVVSVGLGTPAKQYAVIFDTGSDLSWVQCKPC 180 >09_04_0547 + 18467016-18467205,18467922-18469189 Length = 485 Score = 36.7 bits (81), Expect = 0.020 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 Y + +GTP + + V+FDTGS WV K C Sbjct: 149 YVVSVGLGTPAKQYAVIFDTGSDLSWVQCKPC 180 >07_03_0708 - 20865786-20867153 Length = 455 Score = 36.7 bits (81), Expect = 0.020 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +2 Query: 308 ISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 IS+GTPP F V+ DTGS+ +W C Sbjct: 95 ISLGTPPLDFPVIVDTGSNLIWAQCAPC 122 >01_06_0523 - 30009191-30010531 Length = 446 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 454 +Y+ ++ +GTP +V DTGS +W+ C +D R+S TY Sbjct: 85 EYFALVGVGTPSTKAMLVIDTGSDLVWLQCSPCR--RCYAQRGQVFDPRRSSTY 136 >03_02_0806 + 11391880-11391916,11392247-11393634 Length = 474 Score = 36.3 bits (80), Expect = 0.026 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 287 DAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 D +Y ++IGTPPQ +++ DTGS W C Sbjct: 108 DTEYLVHMAIGTPPQPVQLILDTGSDLTWTQCAPC 142 >01_06_0905 + 32880368-32880633,32882439-32882568,32882704-32882894, 32883625-32883852,32884062-32884224,32884343-32884416, 32884484-32884601,32884722-32884788,32885152-32885223, 32885350-32885513 Length = 490 Score = 36.3 bits (80), Expect = 0.026 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +2 Query: 251 DCPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 D P + ++ Y+ + +G+PP+ + V DTGS LWV C Sbjct: 76 DFPVEGSANPFMVGLYFTRVKLGSPPKEYFVQIDTGSDILWVACSPC 122 >12_01_0345 - 2649701-2650819 Length = 372 Score = 35.9 bits (79), Expect = 0.035 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 +Y+ IS+GTPP V DTGS+ WV K C Sbjct: 24 KYFMGISLGTPPVFNLVTIDTGSTLSWVQCKNC 56 >06_03_1412 + 29993566-29993873,29993960-29994583,29994665-29994800, 29995108-29995196,29995299-29995413,29995565-29995628, 29995711-29995782,29995906-29996153 Length = 551 Score = 35.9 bits (79), Expect = 0.035 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVP--SKKC 391 +Y +++GTP +F V DTGS WVP K+C Sbjct: 105 HYAEVAVGTPNTTFLVALDTGSDLFWVPCDCKQC 138 >03_02_0811 + 11437654-11438958 Length = 434 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +2 Query: 260 SPEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 SP N + Y V ++IGTPPQ ++ DTGS +W + C Sbjct: 69 SPGTYDNGVPTTEYLVHLAIGTPPQPVQLTLDTGSDLIWTQCQPC 113 >03_02_0809 + 11419318-11420493 Length = 391 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +2 Query: 260 SPEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 SP N + Y V ++IGTPPQ ++ DTGS +W + C Sbjct: 22 SPGAYDNGVPTTEYLVHLAIGTPPQPVQLTLDTGSDLIWTQCQPC 66 >03_02_0807 + 11398845-11399999 Length = 384 Score = 35.5 bits (78), Expect = 0.046 Identities = 18/54 (33%), Positives = 29/54 (53%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 454 +Y ++IGTPPQ ++ DTGS +W + C L + YD+ +S T+ Sbjct: 34 EYLLHLAIGTPPQPVQLTLDTGSVLVWTQCQPCAVCFNQSLPY--YDASRSSTF 85 >02_05_0626 - 30456714-30456829,30456951-30457023,30457136-30457250, 30457368-30457450,30457532-30457685,30457859-30458095, 30458212-30458435,30458657-30458774,30459286-30459614 Length = 482 Score = 35.5 bits (78), Expect = 0.046 Identities = 20/54 (37%), Positives = 25/54 (46%) Frame = +2 Query: 287 DAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 448 D QYY I +G PP+ + + DTGS W+ TN A H Y K K Sbjct: 109 DGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQC-DAPCTNCAKGPHPLYKPAKEK 161 Score = 31.5 bits (68), Expect = 0.74 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 5/83 (6%) Frame = +1 Query: 508 LLSTDDV----TVGGLKVRRQTFAEAVSEPGLAFVA-AKFDGILGMAFSTIAVDHVTPVF 672 +L+ DD+ T GG + F A + G + AK DGILG++ + I++ Sbjct: 201 VLARDDMHIITTNGGREKLDFVFGCAYDQQGQLLASPAKTDGILGLSSAGISLP------ 254 Query: 673 DNMVAQGLVQPVFSFYLNRDPGG 741 + QG++ VF + RDP G Sbjct: 255 SQLANQGIISNVFGHCITRDPNG 277 >02_05_0552 - 29911280-29912541,29912633-29912762 Length = 463 Score = 35.5 bits (78), Expect = 0.046 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Frame = +2 Query: 263 PEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSR 439 P L + LD Y + + +GTP + V DTGS WV C +D Sbjct: 115 PTKLGSSLDTLEYVISVGLGTPAVTQTVTIDTGSDVSWVQCNPCPNPPCYAQTGALFDPA 174 Query: 440 KSKTYVA 460 KS TY A Sbjct: 175 KSSTYRA 181 >01_06_0258 + 27950196-27950749,27953670-27954570 Length = 484 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH 394 QY+ +GTP Q F +V DTGS WV KCH Sbjct: 86 QYFVRFRVGTPAQPFLLVADTGSDLTWV---KCH 116 >01_05_0656 + 24011784-24011844,24012737-24012862,24014761-24016052 Length = 492 Score = 35.5 bits (78), Expect = 0.046 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 3/69 (4%) Frame = +2 Query: 263 PEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLH--NKYD 433 P L + LD Y + + +G+P + +VV DTGS WV + C + C H +D Sbjct: 136 PTTLGSSLDTLEYVISVGLGSPAVTQRVVIDTGSDVSWVQCEPCPAPS-PCHAHAGALFD 194 Query: 434 SRKSKTYVA 460 S TY A Sbjct: 195 PAASSTYAA 203 >09_04_0355 + 16922863-16924224 Length = 453 Score = 35.1 bits (77), Expect = 0.060 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 287 DAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 D +Y +++GTPPQ + DTGS +W C Sbjct: 95 DLEYVLDLAVGTPPQPITALLDTGSDLIWTQCDTC 129 >09_04_0353 + 16915618-16916934 Length = 438 Score = 35.1 bits (77), Expect = 0.060 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 272 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 L + + +Y + IG+PP+ F + DTGS +W C Sbjct: 77 LLRFSEGEYLMDVGIGSPPRYFSAMIDTGSDLIWTQCAPC 116 >04_04_1647 + 35032328-35033803 Length = 491 Score = 35.1 bits (77), Expect = 0.060 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVP 379 Y +S+GTPPQ V+ +TGS WVP Sbjct: 89 YAFTVSLGTPPQPLPVLLETGSHLSWVP 116 >04_04_0042 + 22328464-22329858 Length = 464 Score = 35.1 bits (77), Expect = 0.060 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYVA 460 +Y + IGTPP F DT S +W + C T + ++ R S TY A Sbjct: 88 EYLVKLGIGTPPYKFTAAIDTASDLIWTQCQPC--TGCYHQVDPMFNPRVSSTYAA 141 >04_03_0432 - 15861997-15862096,15862449-15862519,15862612-15862774, 15865311-15865535,15866156-15866403,15866489-15866618, 15866716-15866975 Length = 398 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 YY I IGTP + + V DTGS LWV C Sbjct: 89 YYTEIGIGTPTKRYYVQVDTGSDILWVNCISC 120 >05_04_0147 - 18419864-18421297 Length = 477 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +2 Query: 257 PSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 PS P + Y + +GTPPQ FD S +WVP ++C Sbjct: 76 PSQAPATT--GGTYLITVGVGTPPQYVYGAFDISSQFVWVPCEEC 118 >11_01_0539 + 4268326-4268450,4268586-4268751 Length = 96 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = +2 Query: 281 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWV----PSKKCHYTNIACLLHNK 427 Y +++ ++IG P + + + DTGS WV P + CH +A LL K Sbjct: 39 YPSGRFFVTMNIGVPEKPYFLDIDTGSDLTWVECDAPCQSCHQACVALLLTPK 91 >04_04_0040 + 22322839-22324173 Length = 444 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 308 ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTY 454 +SIGTP ++ + DTGS +W K C + C + +D S TY Sbjct: 99 VSIGTPALAYSAIVDTGSDLVWTQCKPC----VDCFKQSTPVFDPSSSSTY 145 >07_03_0704 + 20831071-20832381 Length = 436 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 308 ISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 IS+GTP +F VV DTGS +W C Sbjct: 90 ISVGTPLLTFSVVADTGSDLIWTQCAPC 117 >05_04_0099 - 17991569-17993014 Length = 481 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 QY IG PPQ + V DTGS +W C Sbjct: 77 QYIASYGIGDPPQPAEAVVDTGSDLVWTQCSTC 109 >04_03_0428 - 15820169-15820236,15820296-15820367,15820450-15820519, 15824222-15824312,15825023-15825093,15825176-15825341, 15826169-15826393,15829075-15829307,15829464-15829618, 15829636-15829855 Length = 456 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 YY I IGTP + V DTGS WV C Sbjct: 84 YYTDIGIGTPAVKYYVQLDTGSKAFWVNGISC 115 >04_03_0418 - 15686775-15686842,15686902-15686973,15687056-15687125, 15690828-15690918,15691629-15691699,15691782-15691947, 15692775-15692999,15695681-15695913,15696070-15696224, 15696242-15696461 Length = 456 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 YY I IGTP + V DTGS WV C Sbjct: 84 YYTDIGIGTPAVKYYVQLDTGSKAFWVNGISC 115 >02_03_0194 - 16215032-16215177,16215322-16215393,16215518-16215593, 16215984-16216074,16216188-16216258,16216344-16216506, 16218841-16219065,16219206-16219507,16219551-16219680, 16219783-16220045 Length = 512 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 Y+ I IGTP + + V DTGS LWV C Sbjct: 90 YFTRIGIGTPAKRYYVQVDTGSDILWVNCVSC 121 >02_02_0636 + 12463660-12465204 Length = 514 Score = 33.5 bits (73), Expect = 0.18 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 +Y + +GTPP+ F+++ DTGS W+ C Sbjct: 151 EYLVDLYVGTPPRRFQMIMDTGSDLNWLQCAPC 183 >12_02_0913 + 24246217-24247557 Length = 446 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 454 QY IG PPQ + + DTGS +W C A Y+S S T+ Sbjct: 89 QYVAEYLIGDPPQRAEALIDTGSDLVWTQCSTCLRKVCARQALPYYNSSASSTF 142 >06_01_1092 + 8966584-8967053,8967737-8967854,8968030-8968253, 8968352-8968588,8969122-8969275,8969356-8969438, 8969573-8969687,8969837-8969909,8970005-8970147 Length = 538 Score = 33.1 bits (72), Expect = 0.24 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 287 DAQYYGVISIGTPPQSFKVVFDTGSSNLWV 376 D QYY + IG PP+ + + DTGS W+ Sbjct: 156 DGQYYTSMYIGNPPRPYFLDVDTGSDLTWI 185 >02_05_0551 + 29907768-29907909,29907995-29909280 Length = 475 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYVA 460 QY +S+GTP + + DTGS WV K C +D +S +Y A Sbjct: 141 QYVVTVSLGTPAVAQTLEVDTGSDVSWVQCKPCPSPPCYSQRDPLFDPTRSSSYSA 196 >12_01_0494 + 3931664-3931830,3932034-3932151,3932661-3932896, 3932992-3933225,3933659-3933797,3933878-3934096, 3934148-3934220,3934319-3934428 Length = 431 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +2 Query: 281 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIAC--LLHNKYDSRKSK 448 Y YY +SIG PP+ + + DTGS W+ +C ++C + H Y K+K Sbjct: 53 YPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWL---QCDAPCVSCSKVPHPLYRPTKNK 107 >06_01_0746 + 5580755-5582119 Length = 454 Score = 32.7 bits (71), Expect = 0.32 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 +Y +S+GTPP+ + DTGS +W C Sbjct: 89 EYLMHVSVGTPPRPVALTLDTGSDLVWTQCAPC 121 >01_01_0261 + 2119519-2121033 Length = 504 Score = 32.7 bits (71), Expect = 0.32 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 +Y+ + +G+P + +V DTGS WV + C Sbjct: 166 EYFSRVGVGSPARQLYMVLDTGSDVTWVQCQPC 198 >08_01_0711 - 6275052-6276401 Length = 449 Score = 32.3 bits (70), Expect = 0.43 Identities = 18/62 (29%), Positives = 29/62 (46%) Frame = +2 Query: 269 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 448 P Y D Y + IG Q ++ DTGSS +W +C + +I + Y +S+ Sbjct: 73 PFRIYEDVVYLAEMEIGERQQKQYLLIDTGSSLVWTQCDECPHCHIGDV--PPYGRSQSR 130 Query: 449 TY 454 T+ Sbjct: 131 TF 132 >07_03_0710 - 20873420-20874745 Length = 441 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = +2 Query: 290 AQYYGVISIGTPPQSFKVVFDTGSSNLW----VPSKKC 391 A Y I+IGTPP V DTGS +W P ++C Sbjct: 90 ATYLVDIAIGTPPLPLTAVLDTGSDLIWTQCDAPCRRC 127 >05_07_0071 - 27481876-27482737,27484328-27484950 Length = 494 Score = 32.3 bits (70), Expect = 0.43 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWV 376 QY+ +GTP Q F ++ DTGS WV Sbjct: 109 QYFVRFRVGTPAQPFVLIADTGSDLTWV 136 >04_04_1586 - 34621945-34623366 Length = 473 Score = 32.3 bits (70), Expect = 0.43 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 +Y+ + +G+PP +V D+GS +WV + C Sbjct: 129 EYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPC 161 >11_02_0009 - 7315669-7315686,7316239-7316259,7316425-7316519, 7317445-7317502,7317701-7317792,7318101-7318227 Length = 136 Score = 31.9 bits (69), Expect = 0.56 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +2 Query: 380 SKKCHYTNIACLLHNKYDSRKSKTYVANGTQFAIQYG 490 S C IAC H +Y S + TY NG AIQYG Sbjct: 66 SLTCCSFYIACFFH-RYKSEQPSTYRKNGKPAAIQYG 101 >10_08_0770 + 20459888-20461036 Length = 382 Score = 31.9 bits (69), Expect = 0.56 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = +2 Query: 293 QYYGVIS--IGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 454 + Y V S IGTPPQ D G +W +C ++ +D KS TY Sbjct: 21 ELYNVASFTIGTPPQPASAFIDVGGLLVWTQCSQCSSSSCFNQELPPFDPTKSSTY 76 >08_02_0960 + 23058393-23059739 Length = 448 Score = 31.9 bits (69), Expect = 0.56 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 +Y ++IGTPP + + DTGS +W C Sbjct: 91 EYLMDLAIGTPPLRYTAMVDTGSDLIWTQCAPC 123 >04_01_0509 + 6668208-6668653,6669776-6669779 Length = 149 Score = 31.9 bits (69), Expect = 0.56 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 +Y+ IG PPQ + + DTGS+ +W C Sbjct: 80 EYFTEYLIGDPPQHAEAIVDTGSNLVWTQCTDC 112 >03_02_0519 + 9066918-9068261 Length = 447 Score = 31.9 bits (69), Expect = 0.56 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 308 ISIGTPPQSFKVVFDTGSSNLWV 376 +++GTPPQ+ +V DTGS W+ Sbjct: 59 VAVGTPPQNVTMVLDTGSELSWL 81 >07_03_1115 - 24076506-24076677,24077169-24077266,24077622-24077743, 24079059-24079235,24079809-24079897,24079919-24079965, 24080423-24080519,24080600-24080682,24080716-24080796, 24081043-24081199,24081323-24081750,24081985-24082014, 24083180-24083300,24083432-24083697 Length = 655 Score = 31.5 bits (68), Expect = 0.74 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 296 YYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 YY + IGTP Q F ++ D+GS+ +VP C Sbjct: 90 YYTTRLYIGTPSQEFALIVDSGSTVTYVPCATC 122 >04_03_0316 + 14261942-14262506,14262710-14263134 Length = 329 Score = 31.5 bits (68), Expect = 0.74 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 +Y ++ GTP Q ++ DTGS W K+C Sbjct: 43 EYLVHLAAGTPRQEVQLTLDTGSDIAWTQCKRC 75 >04_03_0281 - 13872289-13872891 Length = 200 Score = 31.5 bits (68), Expect = 0.74 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 614 SNLAATKASPGSDTASANVWRRTLSPPTVTSSVERSRRGCRSR 486 + L A A+ + A+ TL PP ++ S+ RS GCR R Sbjct: 16 ARLLAPAAAAAAAAAATRASFSTLRPPAISLSLSRSAAGCRGR 58 >01_06_1318 - 36261483-36262811 Length = 442 Score = 31.5 bits (68), Expect = 0.74 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 308 ISIGTPPQSFKVVFDTGSSNLWV 376 +++GTPPQ+ +V DTGS W+ Sbjct: 70 LAVGTPPQNVTMVLDTGSELSWL 92 >04_01_0470 - 6062054-6062134,6062262-6062528,6062578-6062583 Length = 117 Score = 31.1 bits (67), Expect = 0.98 Identities = 26/83 (31%), Positives = 36/83 (43%), Gaps = 2/83 (2%) Frame = -1 Query: 617 PSNLAATKASPGSDTASANVWRRTLSPP--TVTSSVERSRRGCRSRTVSRTGCHSRRTSW 444 P + T GSD S N WR PP S++ S R + +GC++R T W Sbjct: 21 PCSRYTTMRRRGSDATSPNSWR----PPHMATISAMSESLRFTNATDSLNSGCNARVT-W 75 Query: 443 TCGCRTCCAANKRCWCSGTFWKA 375 R AA++ SG+ W A Sbjct: 76 EMAPRETLAASR----SGSPWSA 94 >01_05_0596 + 23511148-23512650 Length = 500 Score = 31.1 bits (67), Expect = 0.98 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +2 Query: 293 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCH 394 +Y+ I +GTP +V DTGS +W+ P ++C+ Sbjct: 146 EYFTKIGVGTPVTPALMVLDTGSDVVWLQCAPCRRCY 182 >10_08_0769 + 20452130-20453314 Length = 394 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 Y +IGTPPQ V D +W K+C Sbjct: 51 YVANFTIGTPPQPASAVIDLAGELVWTQCKQC 82 >10_08_0766 + 20437772-20438956 Length = 394 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 Y +IGTPPQ V D +W K+C Sbjct: 51 YVANFTIGTPPQPASAVIDLAGELVWTQCKQC 82 >02_05_0554 + 29929860-29929959,29932944-29934220 Length = 458 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHN--KYDSRKSKTYVANG 466 Y + +GTP + +V DTGSS W+ C ++C + ++ + S TY + G Sbjct: 122 YVTRMGLGTPATQYVMVVDTGSSLTWLQCSPC---LVSCHRQSGPVFNPKSSSTYASVG 177 >12_02_0674 - 21745321-21746223,21746229-21747608 Length = 760 Score = 29.9 bits (64), Expect = 2.3 Identities = 27/114 (23%), Positives = 45/114 (39%), Gaps = 2/114 (1%) Frame = -1 Query: 743 SPPGSLLR*NEKTGCTSP*ATMLSNTGVTWSTAIVLKAIPRIPSNLAATKASPGSDTASA 564 SP + T TSP +T S T T ST+ + + +IP+ + S +D Sbjct: 579 SPLSTATGKTSSTPSTSPLSTSTSKTSSTPSTSPLSSSTIKIPTTARTGELSTPTDKIPT 638 Query: 563 NVWRRTLSPPT--VTSSVERSRRGCRSRTVSRTGCHSRRTSWTCGCRTCCAANK 408 LS T + ++ S + +S T C + ++ T G T +K Sbjct: 639 TTRAGDLSTATSKIPTAPGTSELSTTTSKISSTSCAGQFSTSTYGIPTTTCTSK 692 >10_08_0775 + 20484776-20486035 Length = 419 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/57 (28%), Positives = 22/57 (38%) Frame = +2 Query: 290 AQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYVA 460 A Y +IGTPPQ+ + D +W C + +D S TY A Sbjct: 60 AHYVANFTIGTPPQAVSGIVDLSGELVWTQCAACRSSGCFKQELPVFDPSASNTYRA 116 >06_01_0772 + 5770502-5770619,5771035-5772335 Length = 472 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 275 SNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 S+ D + +S+G PP V DTGS+ WV + C Sbjct: 107 SSINDFLFLMAVSLGKPPVVNLVAIDTGSTLSWVQCQPC 145 >04_03_0444 - 16006619-16006733,16006754-16007048,16008265-16008967 Length = 370 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -1 Query: 668 TGVTWSTAIVLKAIPRIPSNLAATKASPGSDTASANVWRRTLSPPTVTSS 519 T TWS+ + +P +P + + PGS RR++SP T TSS Sbjct: 156 TTTTWSSTSDVAFLPPLPLQVVELRLLPGSRPVIDQ--RRSVSPTTSTSS 203 >10_06_0011 - 9581916-9582167,9582523-9582574,9584105-9584331 Length = 176 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 558 DVRRGRVGARACLRGRQVRRDPRDGLQH 641 D G A CL G+++ R+P GL+H Sbjct: 109 DAEHGMHSANGCLAGQRLLREPHHGLRH 136 >08_02_1095 - 24278295-24278741,24279066-24279307,24279647-24279731, 24279783-24280004 Length = 331 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -1 Query: 482 VSRTGCHSRRTSWTCGCRTCCAANKRCW 399 V+ G S R SW C R C N CW Sbjct: 167 VASRGRTSNRISWRCPGRRCAFRNDWCW 194 >10_08_0774 + 20478203-20479393 Length = 396 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 278 NYLDAQYYGVISIGTPPQSFKVVFDTGSSNLW 373 ++ A Y ++IGTPPQ + D G +W Sbjct: 45 HFSQAFYVVNLTIGTPPQPVSAIIDIGGELVW 76 >06_03_1283 - 28957729-28959258,28959354-28959550,28959824-28960026, 28960097-28960424,28960524-28960661,28960765-28961020, 28961529-28961626,28963104-28963367,28964395-28964584 Length = 1067 Score = 28.7 bits (61), Expect = 5.2 Identities = 19/63 (30%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = -3 Query: 717 EREDGLHESLSHHVVEHRGHMVHCDSAEG-HPEDPVELGGHEGKPGLRHGLGERLAPHLE 541 E LH + H EH +HCD G H D HE + H E+ PH Sbjct: 860 EEPVALHSTGEHACHEHEHEHIHCDEPIGSHCADKHACHDHE-QVHEHHCCDEQQTPHTA 918 Query: 540 PAH 532 H Sbjct: 919 DLH 921 >04_04_1013 + 30109321-30110790 Length = 489 Score = 28.7 bits (61), Expect = 5.2 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Frame = +2 Query: 296 YYGVISIGTPPQSFK---VVFDTGSSNLWVPSKKCHYTNIACLL-HNKYDSRKSKTY 454 Y + IGTP V+FDTGS W + C TN + + +D KS+T+ Sbjct: 122 YLVQLRIGTPTDRISPRYVLFDTGSDLSWTQCEPC--TNCSSFTPYPPHDPSKSRTF 176 >04_04_1006 + 30048618-30050087 Length = 489 Score = 28.7 bits (61), Expect = 5.2 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Frame = +2 Query: 296 YYGVISIGTPPQSFK---VVFDTGSSNLWVPSKKCHYTNIACLL-HNKYDSRKSKTY 454 Y + IGTP V+FDTGS W + C TN + + +D KS+T+ Sbjct: 122 YLVQLRIGTPTDRISPRYVLFDTGSDLSWTQCEPC--TNCSSFTPYPPHDPSKSRTF 176 >03_02_0810 + 11429776-11429985,11430003-11430935 Length = 380 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 290 AQYYGVISIGTPPQSFKVVFDTGS 361 ++Y ++IGTPPQ ++ DTGS Sbjct: 34 SEYLVHLTIGTPPQPVQLTLDTGS 57 >01_07_0213 - 42028941-42029055,42029444-42029480,42029876-42030244, 42030332-42031201,42051574-42052891 Length = 902 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 Query: 296 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 Y +GTP Q+ V D + WVP C Sbjct: 102 YIARAGLGTPAQTLLVAIDPSNDAAWVPCSAC 133 >01_06_1474 + 37630471-37631736,37631965-37632028,37632928-37633124 Length = 508 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 Query: 260 SPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 S +P +N Y S+GTPPQ V D S +W+ C Sbjct: 87 SQDPATN--TGMYVLSFSVGTPPQVVTGVLDITSDFVWMQCSAC 128 >10_08_0778 + 20492822-20493920,20494605-20494648 Length = 380 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 281 YLDAQ--YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 391 YL +Q Y +IGTPPQ V D +W C Sbjct: 50 YLSSQGLYVANFTIGTPPQPVSAVVDLTGELVWTQCTPC 88 >06_03_0635 - 22971502-22973840,22974112-22974403,22974639-22975162, 22975314-22975583,22976393-22977124,22977226-22977310 Length = 1413 Score = 28.3 bits (60), Expect = 6.9 Identities = 23/58 (39%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +3 Query: 534 GRAQGAAPDVRRGRVGARACLRGRQVRRDPRDGLQHYRSGPC--DPGVRQHGGSGTRA 701 G QGA P VRR R G R RR +DG R+G P R+ GG RA Sbjct: 71 GGQQGAEPAVRRVRGGVGGQQGARPQRRRRQDGAA-VRAGDARQRPWHRRQGGPQPRA 127 >03_04_0243 + 19298293-19299117 Length = 274 Score = 28.3 bits (60), Expect = 6.9 Identities = 24/87 (27%), Positives = 35/87 (40%) Frame = -1 Query: 707 TGCTSP*ATMLSNTGVTWSTAIVLKAIPRIPSNLAATKASPGSDTASANVWRRTLSPPTV 528 TG T + + W +V ++ R P A +P S W RT +PP Sbjct: 151 TGATGYIGCFVVRELLRWGHPVVTDSLSRAPGAAWAAAMAPTS-------WSRTSAPP-A 202 Query: 527 TSSVERSRRGCRSRTVSRTGCHSRRTS 447 +SS RR S T SR + R++ Sbjct: 203 SSSPTSPRRARSSLTCSRVAPSTPRSA 229 >02_05_0180 - 26519845-26520684 Length = 279 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -1 Query: 593 ASPGSDTASANVWRRTLSPPTVTSSVERSRRGCRSRTVSRTGCHSR 456 A S ++A W SPP+V +V RSR+ + T + S+ Sbjct: 143 AETDSSASTAGFWGAAPSPPSVLDAVCRSRKPAATATAAAPSAMSK 188 >11_01_0720 - 5943243-5944399,5946142-5946271 Length = 428 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +2 Query: 308 ISIGTPPQSFKVVFDTGSSNLWV--PSKKCHYTNIACLLHNK 427 + +GTP ++ V DTGSS WV CH TN L ++ Sbjct: 86 VGLGTPAKTQIVEIDTGSSTSWVFCECDGCH-TNPRTFLQSR 126 >10_08_0773 + 20474642-20475835 Length = 397 Score = 27.9 bits (59), Expect = 9.2 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +2 Query: 311 SIGTPPQSFKVVFDTGSSNLWVPSKKC 391 +IGTPPQ + D +W +C Sbjct: 48 TIGTPPQPASAIIDVAGELVWTQCSRC 74 >10_08_0083 - 14715517-14715595,14716022-14716150,14716280-14716487, 14716789-14716852,14717727-14717768,14718175-14718279, 14718601-14718695,14718789-14718882 Length = 271 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 389 CHYTNIACLLHNKYDSRKSKTYVANG 466 C++ +AC H+ Y S +S TY NG Sbjct: 60 CNW-KVACFFHSHYKSGQSSTYQKNG 84 >06_03_0395 - 20354713-20355570 Length = 285 Score = 27.9 bits (59), Expect = 9.2 Identities = 24/85 (28%), Positives = 32/85 (37%), Gaps = 6/85 (7%) Frame = -1 Query: 599 TKASPGSDTASANVWRRTLSPPTVTSSVERSRRGCRSR-----TVSRTGCHSRRTSWTCG 435 T+ P + +A+ RR PP +E GC R T T + TS C Sbjct: 108 TQIRPRAAVDAADRGRRRQPPPPTAPPLEAPANGCCRRCRGPSTAVATATGAPSTSLPCC 167 Query: 434 CRTCCAANKRCWCSGTFWKAP-RGW 363 CR A++ T W P GW Sbjct: 168 CRHVVASSA---APATSWLDPAAGW 189 >06_01_1084 + 8883301-8883515,8883736-8884063,8884764-8885022, 8885581-8885681 Length = 300 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 557 WRRTLSPPTVTSSVERSRRGCRSRTVSRTGCHSRRTSWTCGC 432 WRR P V +RRGC R V R W GC Sbjct: 4 WRRRALAPRVLLGA--ARRGCLRRAVPAPRMAPRGRRWDAGC 43 >01_06_1068 - 34270420-34270581,34272185-34272238,34273741-34274070 Length = 181 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 518 VERSRRGCRSRTVSRTGCHSRRTSWTCG-CRTCCAANKRCWCS 393 + R R ++ + C++R TS + G CR CC R W + Sbjct: 32 LRRQSREEQASVPAPPACYTRSTSRSIGRCRGCCRRRPRGWAA 74 >01_01_1006 - 7972645-7973811 Length = 388 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 672 EHRGHMVHCDSAEGHPEDPVELGGHEGKPGLRHG 571 +H G ++ C S PE PV + G G+ HG Sbjct: 84 DHHGRLLLCASQGPEPEPPVLDAFYRGPLGVHHG 117 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,312,863 Number of Sequences: 37544 Number of extensions: 507551 Number of successful extensions: 1984 Number of sequences better than 10.0: 92 Number of HSP's better than 10.0 without gapping: 1870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1971 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2004270760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -