BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0525 (752 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 26 1.4 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 25 1.9 AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-tran... 23 7.7 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 7.7 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 23 7.7 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 25.8 bits (54), Expect = 1.4 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Frame = -3 Query: 717 EREDGLHESLSHHV--VEHRGHMVHCDSAE-GHPEDPVELGGHE--GKPGLRHGLGERLA 553 E + +H + HH+ + V S GHPE P+ +GG E K +R+ LG + Sbjct: 684 EAVERVHAWMRHHLQLAPEKTECVMISSLRRGHPEIPIRVGGLEIRSKQAIRY-LGVMIH 742 Query: 552 PH 547 H Sbjct: 743 DH 744 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 25.4 bits (53), Expect = 1.9 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -1 Query: 521 SVERSRRGCRSRTVSRTGCHSRRTSWTCGCRTCCAANKRCWCSGT 387 S RSR RSR+ S G SR S + G R+ + R +G+ Sbjct: 1097 SRSRSRSRSRSRSGSAKGSRSRSRSGSGGSRSRSRSRSRSQSAGS 1141 Score = 23.4 bits (48), Expect = 7.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 Query: 524 SSVERSRRGCRSRTVSRTGCHSRRTS 447 S R R RSR+ SR+G SR S Sbjct: 1154 SQASRGSRRSRSRSRSRSGSRSRSRS 1179 >AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 23.4 bits (48), Expect = 7.7 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 394 VALFGRHPEVGGSGVEYHLERLRRRADT 311 +A+FGR PE+ +EY + R D+ Sbjct: 120 LAIFGRKPEIPEDRIEYVRKAYRLLEDS 147 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 23.4 bits (48), Expect = 7.7 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 207 EVGTELELLRLKYDVTALHPN 269 EVG E++ +Y + +HPN Sbjct: 251 EVGVEVKFKHFEYPSSPIHPN 271 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 23.4 bits (48), Expect = 7.7 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = -1 Query: 602 ATKASPGSDTASANVWRRTLSPPTVTSSVERSRRGCRSRTVSRTGCHSRR 453 ++ AS S A+ W R S ++S SR S +G HS R Sbjct: 17 SSSASLRSSAANFAAWLRGNSGSPLSSISSSSRNSSSCNNSSSSGTHSDR 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 807,753 Number of Sequences: 2352 Number of extensions: 17616 Number of successful extensions: 42 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -